SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000065659 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000065659
Domain Number 1 Region: 29-261
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-65
Family Nuclear receptor ligand-binding domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000065659   Gene: ENSDARG00000044685   Transcript: ENSDART00000065660
Sequence length 264
Comment pep:known chromosome:Zv9:16:58399651:58404664:1 gene:ENSDARG00000044685 transcript:ENSDART00000065660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRAGETHTHTIIIIIMDCGCDCADFAQPNAILFNILSRGEFSYKRVPQTCHCEKRRRVC
LQTPSETCALASDVLVKTVYFMKNLPAFQQLPPKDQLKLLQNCWTPLFILGLAQDRVHFQ
VDESAAPSMLKRILLSGQESAGADSEQPTLAGVQTLKSCINKFWSLDLSPKEYAYLKGTV
IFNPDVPDLKASLFVEGLQYEAQQALKEVLVPLYPQDGGRFARILLTASTLKSITPSLIT
ELFFRPVIGDAQILDLLADMLFSR
Download sequence
Identical sequences ENSDARP00000065659 7955.ENSDARP00000065659 ENSDARP00000065659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]