SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000067629 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000067629
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-40
Family BAR domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 169-233
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-23
Family SH3-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000067629   Gene: ENSDARG00000039901   Transcript: ENSDART00000067630
Sequence length 236
Comment pep:known_by_projection chromosome:Zv9:23:45061970:45067477:-1 gene:ENSDARG00000039901 transcript:ENSDART00000067630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GESMRELGEVKDALDITVKQNFIDPLQNLHDKDLKEIQHHLKKMEGRRLDFDYKKKRQGK
VTDDEIKQALEKFDESKEIAEQSMFNLLENDIEQVSQLAALVQAQVEYHQQAAEILQQLS
SKIEDSRVKEMSDKPRKEFIPKPRMELQLPIETLNGGINSAKSPARSPGLSAPLDQPCCR
ALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMIHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences ENSDARP00000067629 ENSDARP00000067629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]