SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000069897 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000069897
Domain Number 1 Region: 19-229,277-351
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.18e-32
Family WD40-repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000069897   Gene: ENSDARG00000053386   Transcript: ENSDART00000075414
Sequence length 450
Comment pep:known chromosome:Zv9:13:35750199:35760216:1 gene:ENSDARG00000053386 transcript:ENSDART00000075414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVTSEQYFIERFSVTCSKPVSHLQLACCPSHCAIPWKDKNIRIYENKINNLEPPLELT
GHHGDVSAMVFGTERDQPILCSASEDYVIVWDINRCYRQIKEGGIASGRVVGTLLGRVVY
LSLCPMSAKVAACSGSRVVLLNAEREEVLGVLKAHLGPVTASEFCPWDVNLLISISEDRT
FKIWDVKKGGILFESAVLSAYPLLSLSFMKQNGQFITGSGDGQLWCYTLPVDHKCRLVTK
LDLSKLEQKHERNLRMISPPQSRTDGTARCDERGAVETAKPVLRIWPQTPKINHASLQQR
GSYVWIGSSDGLCLLDLDTSELLSFLPLKGDLSISIAGSWVISEGLDGSMRCLVSSLFET
SVVLLVVNGVRLDELCLRMAKSFSVEEQLSVMPSSPLMTTSPLKAELAKKGPKPQRKGGW
SSQNHTKHTQAFCCQIHKSPSLDLQAFQYH
Download sequence
Identical sequences B8JJR0
ENSDARP00000069897 ENSDARP00000069897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]