SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070464 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070464
Domain Number 1 Region: 518-733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-104
Family Thrombospondin C-terminal domain 0.0000000975
Further Details:      
 
Domain Number 2 Region: 391-516
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.98e-36
Family TSP type-3 repeat 0.00000432
Further Details:      
 
Domain Number 3 Region: 322-393
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000107
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 246-334
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000109
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 5 Region: 28-68
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0000000000654
Family Assembly domain of cartilage oligomeric matrix protein 0.00071
Further Details:      
 
Domain Number 6 Region: 107-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000566
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 160-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000561
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000070464
Domain Number - Region: 214-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-like domain of nidogen-1 0.047
Further Details:      
 
Domain Number - Region: 77-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070464   Gene: ENSDARG00000053865   Transcript: ENSDART00000075985
Sequence length 749
Comment pep:known_by_projection chromosome:Zv9:11:7027490:7053714:-1 gene:ENSDARG00000053865 transcript:ENSDART00000075985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWSLCFSCYFYLHSALVSAQGISRDGEIIKQIKGTNQELAEIKELLKQQIQEIVFLKNT
VMECEACGMRPADLQPSCDPNPCHSGVECIVTPNGIKCGACPAGMTGDGTHCEDVDECTV
IPCHMGVRCINTSPGFRCGPCPAGYTGQQVQGVGIPYASANKQVCTDINECANSNGGCVE
NSNCINTPGSFRCGRCNAGFVGDQVKGCKAERTCGNGQPNPCHASAECIVHRDGQIECAC
GVGWAGNGYLCGTDTDIDGFPDEKLECVERNCAKDNCLTVPNSGQEDADKDNIGDACDDD
ADGDGILNIEDNCVLVPNVNQKNTDQDDYGDACDNCRLVKNNDQKDTDADGQGDECDDDI
DGDGIKNDNDNCKKVPNRDQKDRDGDNVGDACDSCPYIRNPDQTDVDNDLIGDPCDTNKD
SDGDGHQDSRDNCPAVINSSQLDTDKDGIGDECDDDDDNDGIPDLLPPGPDNCRLVPNPL
QEDIDGDGIGNVCENDFDNDTFSDIIDVCPENAEVTLTDFRTYQTVVLDPEGDAQIDPNW
VVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTETDDDYAGFIFGYQDSSSFYV
VMWKQVEQIYWQANPFRAVAEPGIQLKAVKSDTGPGENLRNSLWHTGDSTNQVKLLWKDS
RNVGWKDKTSYRWFLQHRPQEGYIRVRFYEGQQMVADTGVIIDATMRGGRLGVFCFSQEN
IIWANLRYRCNDTIPEDFETFRTQQIQLF
Download sequence
Identical sequences ENSDARP00000070464 ENSDARP00000070464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]