SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000071903 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000071903
Domain Number 1 Region: 184-304
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-24
Family Third domain of FERM 0.0076
Further Details:      
 
Domain Number 2 Region: 83-185
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-22
Family Second domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-19
Family First domain of FERM 0.0027
Further Details:      
 
Domain Number 4 Region: 375-424
Classification Level Classification E-value
Superfamily RING/U-box 0.000045
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000071903   Gene: ENSDARG00000055118   Transcript: ENSDART00000077436
Sequence length 464
Comment pep:known chromosome:Zv9:16:27775274:27788019:1 gene:ENSDARG00000055118 transcript:ENSDART00000077436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCHITRPDSVVLEVEVDPKANGEDILNKICQKMGIIEVDYFGLQFTGTKGESLWMNLRN
RICQEVDCVSPCRLRLRVKFFVEPHLILQEQTRHLFLMHVKEEIIKGSLRLDAEQAIELC
ALLAQAEFGDYKQNTAKYCYSQIYGQDPSHDTINTISLKHKSLEGVSQASAEYQALQLVS
SLTYYGVEWHFARDSEGQELLIGVGQEGLFVCKSDFTPIERLMYPVIQMATQSGRNVYVT
ITKDNGDSVVLLFKFVSPSAANGLYRAITEIHAFYRCDTVMSTVKMQYSRDFKGHLASLF
LNESIDLGKRYIFDIQRTSKEVYDRTRRALFNAGVSVNGRGISRSPLRKTKVDREERMCV
DCRETHVLKEKLQRLQEALTCALCCEQEISAAFCPCGHMFCCYNCASQLQCCPVCRSEVD
RVQHVYLPTCASLLGLAEAKTTNSVLRRTGISEDCANKENARQM
Download sequence
Identical sequences F1QAI4
ENSDARP00000071903 7955.ENSDARP00000071903 ENSDARP00000071903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]