SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073917 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073917
Domain Number 1 Region: 770-846,877-965
Classification Level Classification E-value
Superfamily RUN domain-like 7.98e-38
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1140-1318
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-28
Family RUN domain 0.01
Further Details:      
 
Domain Number 3 Region: 975-1085
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 7.4e-17
Family Lipoxigenase N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073917   Gene: ENSDARG00000003789   Transcript: ENSDART00000079461
Sequence length 1325
Comment pep:known chromosome:Zv9:4:15717726:15774960:-1 gene:ENSDARG00000003789 transcript:ENSDART00000079461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATMSGSGSAPCRFAHYFIVCGLDDETGLEPDALAALYQWLEADRQGKDPEATAAGENF
DQSPLKRTFKSKVLAHYPENIECNPFDQDAVNMLCMPKGLSFRTQRDSLAPHFHSFLITR
EDGSRTYGFVHTFYEEVTSPQICSAMQTLHQMHQAEHNTSAQNCTSSSSSSSSSSSSSSM
DSLSSSLDDVDSPSAHGGRRTCEGYDSIRDTLYVSKAMCLIAPMPFMHACKRFLAQMHRA
VSCSPPPPLPLESYIYNVLYEVPLPASGRSLKFHGVYEPILCQRPGVGELPLADFPLADA
FRLLGVENLVQLFTCVLLEMQILLYSQDYQRLMVVAEGITTLLFPFQWQHVYVPILPASL
LHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHCIELPEDFPQFPNRSEFIQ
ELSEVLLSFGQSPEGGSSSPEPAVMSLQTSVLEKELKSTSLRELVDDKTNGNLGGEALDV
LELLQGNPTLERLQALAKRTGVKVARLEALAAGQKGDEGVGGRSPVEEEELRNAKLNVQL
REVFAARFATMFADYESFVIQNSPDLESWLTNREQMHNFDKASFLSDQPEPYLPFLSHFI
ETQMFATFIDNKIMSQWEEKEPLLRVFDGRIEKARLYNVRAPSLRSSVYQKCTFLKESAQ
AIEQRLRKIDHTAIHPHLLDMKIGQGKYQQGFFPKLQADVLASGPTSNKWSNRTCSTQRR
VERHRQQNEHLVLDNELKEKYMQEARNLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKEC
KMKTKRMLVEKMGREAVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALW
SHLLHYQAREEKNEQQLESPVSNGQERRKTESSVGLPGLRVSVIQDMRHIQNMAEIKTDV
GRARAWIRLSLEKKLLSQHLKQLLSNQALTKKLYKRYAFLRCEEEKEQFLFHLLSLNAVD
YFCFTSVFTTIMIPYRAVIIPIKKLSNAMTTSNPWLCVSGELGDSGILQITKNILEMTFD
SAFRPHTHISIAFKCQNLGKLTTVQLGHDNSGLLAKWLVDCVMVRNEITGHTYKFPCGRW
LGKGVDDGSLERVLIGEFVVPCGDDEGGRGSKTPPLQRSPSQIRRISITSLTGKGNKPTT
VQIQESIGEAVNNIIKHFHKPEKERGSLTVLLCGEGGLVWALEQFFHHGFRSARIFQKNV
FVWDFFERIVAFMENRDQTGDLQESPEPLSLNSESLCRYVNAINNMPRNIGKDGKFQLLV
CLGARDRLLPQWLPLLAESPVITRMYEENALLRDKLTVSSLLGVLETLHDFPITLETSLT
KSVEL
Download sequence
Identical sequences F1QQ55
ENSDARP00000073917 ENSDARP00000073917 XP_005164768.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]