SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074291 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074291
Domain Number 1 Region: 229-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-66
Family Nuclear receptor ligand-binding domain 0.0000000355
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074291   Gene: ENSDARG00000057231   Transcript: ENSDART00000079840
Sequence length 479
Comment pep:novel chromosome:Zv9:8:19410053:19424372:-1 gene:ENSDARG00000057231 transcript:ENSDART00000079840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCIIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLGNGISSHTGD
EAGENGNGHSRAYSRGSSTTLSDLDDITTLPDGLLFDLPLTPEEAADYCSLELLGGSSGN
SSSSQSSPESNRQEFGDVTHIKHEYMSPHESGLFTRSILNPPEGCSLMEIERITQNVIKS
HIETSQYSTEELKRLAWTLYTPEEIRVYQNKPTEMLWQQCAVQLTNAIQYVVEFAKRISG
FMDLSQNDQIILLKAGCLDVLLIRMCRAYNPINNTLLFDGKFASPQLFKALGCDDLVSAV
FEMAKTLSRLQLSEEEMALFTATVLLSPDRPWLTDAQKVQKLQEKVYVALQHYLHKSGVH
EEKLAKMVSKLPMMKSICNLHIDKLEFFRLLHPETAYNFPALYREVFCSEITFPDSTEG
Download sequence
Identical sequences B8JI61
ENSDARP00000074291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]