SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074888 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074888
Domain Number 1 Region: 133-315
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.76e-16
Family beta-CASP RNA-metabolising hydrolases 0.094
Further Details:      
 
Domain Number 2 Region: 17-117
Classification Level Classification E-value
Superfamily ISP domain 0.00000000000183
Family Rieske iron-sulfur protein (ISP) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074888   Gene: ENSDARG00000057714   Transcript: ENSDART00000080439
Sequence length 591
Comment pep:known chromosome:Zv9:4:2091681:2111243:1 gene:ENSDARG00000057714 transcript:ENSDART00000080439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQVSHTVLRLEAEDVRNLKDGINFQKNNKDGKCYIIYKANGELRACRNQCKHQGGLFI
KDIEDMDGRTVRCTKHYWKLNVATMQYVNPPDSFMQDELEAVLSETDGSLELLELNPPDP
WTAEPREAQDLQAGEITLTYITHACMELKAGERRMMFDPWLTGPAFARGWWLLHEPPKDA
MDRLMEADLVYISHMHSDHLSYPTLQHLSKKRPDIPIYVGNTSRPVFWYLEKSGVNLTNI
NVVPFGVWQNVDDHLRFMILMDGVHPEMDTCLIVEYKGHMILNTVDCTRPNNGRLPHGVD
VMMSDFAGGASGFPMTFHGGKYTESWKANFIKNERKKLLNYKAQLVKSLQPKIYCPFAGY
FTEAHPSDRYIKETNTKNSPAELNELIRKSCLNTLTWTPLPGSVLDLAVALNNRSNETAI
TDPPHGTKIYKDNWEFDLYLNQLNASISAEIFKHKHWIQYYYNWAGFRNYNLVIRVIETD
DDFQPLNGGFDYLVDFLDLSFPTERPEREHAYEEIKNRVNVMRHVVVNGLLWDDLYIGFN
NRMSRDPDVYHHKFWNHFQTELPLSAPDWQHFLQICSQTQENGSSNGCSVS
Download sequence
Identical sequences Q6GML1
ENSDARP00000074888 NP_001002192.1.45394 ENSDARP00000074888 7955.ENSDARP00000074888 7955.ENSDARP00000103563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]