SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000076892 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000076892
Domain Number 1 Region: 357-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-43
Family SPRY domain 0.0002
Further Details:      
 
Domain Number 2 Region: 13-83
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-17
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 141-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000107
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000076892   Gene: ENSDARG00000059355   Transcript: ENSDART00000082457
Sequence length 540
Comment pep:novel chromosome:Zv9:23:125134:130616:1 gene:ENSDARG00000059355 transcript:ENSDART00000082457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSKPEERLALELSCPICLQLFRDPVALPCGHNYCLGCIKNAADAEDPKCPKRCPECRE
EYGSPEALPKNFKLSSIVDGFLVATTGGGLKGGTTVPCDQCLDNPVAAVKFCTRCEMSLC
PGHLKKHEERHRSLHVLVGLPAERDGKRCTVHLKVTEYLCVQERLFLCSECLMEGAHQFH
EVQTFEVAKEEMKRVLEELGKLVSDKLQMTETLLKVAQEEPDKPEDRLVARANVLLDNMT
SLINTYKSRMNTAMNDKLHLRDKSRQASLCELEGCLHQLREANQCKDDILCQSSEFLFIQ
NYLNVDAKIRQAANATIPALPVQESSDGKHLRSILCTDAFHTEMSLLLEYLHGVMNPLDL
TFNPATAHPNLLLSGDLKTVKQCAGAKSSVSGDPGERFTSVSQVMCAQGFSTGVHMWAVE
VGPGCAWSVGLCYKSIPRKGDHSRLGHNSSSWRLQWKSKKLTACHDSTSIPVGESLLVPP
KKVEVSLDYEGGTAAFHSSGQGGRKQHLHTFSAVFRDVVFPAFGILSTSEESWITLRSGV
Download sequence
Identical sequences ENSDARP00000076892 ENSDARP00000076892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]