SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000077950 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000077950
Domain Number 1 Region: 400-506
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-29
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 2 Region: 136-247
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.0044
Further Details:      
 
Domain Number 3 Region: 2155-2248
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family Interleukin 16 0.0043
Further Details:      
 
Domain Number 4 Region: 2028-2118
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family Interleukin 16 0.0023
Further Details:      
 
Domain Number 5 Region: 545-641
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-18
Family PDZ domain 0.01
Further Details:      
 
Domain Number 6 Region: 988-1089
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000213
Family PDZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000077950   Gene: ENSDARG00000059801   Transcript: ENSDART00000083515
Sequence length 2251
Comment pep:novel chromosome:Zv9:5:42554616:42623450:-1 gene:ENSDARG00000059801 transcript:ENSDART00000083515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRIKRKAPLPPCNGSNGGNFVDVSNDHRRSVSSETAGSPTHNGQNGKRTRKFGVISRS
SFTRDSKDSKDSRECEHENGYSSMEAEVTSPESSSPQDTPTDDSPITGPSELMMSNHMRV
GSTATLPCRSRSRMSENFKTESISSEPSGQPREGGRIWKMHMVKGQDGLGIQITGGRGSK
RSPHGIIVAHVEEGGATQRDGRLKAGDELLMINGHSLVGLSHQEAVAILRSTAGLVQLVV
ASRDESEVDFHKYPSTSLPDLVSTCSGPDASPSPGEEKENMEPDMEDVRASSLSLPTQDL
FTDHDRLDERGRIEGPKGCCRSPTPMKFRSRSQGGGSRLESVGEDDELIVENGDTGSDVA
EKPTRGGRKHSLPQQLDTVGIRQEYQIVKKSARSLSTVQVESPWRLAQPSIISNIVLMKG
QGKGLGFSIVGGQDSARGRMGIFVKTIFPNGAAAADGRLKEGDEILEVNGESLQGLTHQQ
AIQTFKQLKKGVVTLTVRTRLRSPSLTPCPTPTLLSRSSSPNSNASGGTPVPQSFDEGDS
RKGPGPKDRIIMEVTLNKEPGVGLGIGACCLTLENSAPGIYIHSLAPGSVAKMDGRLSRG
DQLLEVDSVSLRHAALSEAYAILSECGPGPVSLIISRHPNPKVSEQEMDEVITRSTHRDS
HSSHTLGLPSKSPSPTVKVKQGEGNPALSWTMKRFLEPASRQGSLSSEAELSQYFTVHDV
PSQSSLSETMAMGSSDDDMLHSSRSCNTSMEESAAPQPHVYRDGSYRGSGSSPTTPECCK
ASGGTGRTAETAQQASVGSSPSSVRSPLLRQRRVICYEDEPSDDETGLEDDNGPFRRLLR
GVSDGHQHQEEDSGIVIATSSLEVDDESQDGSESHRQISSEPTTPFYGSSIESEEGTTGL
SSAESPFMPIHCVEATNLGVKKEPHREGQEVKRSPKLEHKAVTRVKSMMSIECPNPPQRT
KGEDPALFPANPAQVTQNCTRPPCRMMHCKKGESSELAGVCTIETIVLQRGETESFGLDL
EIKSAPLKVLVTGLRPGGVAEREASGKMSIGDEIVTIGDTPVCTSSYQEICDLMHNLPIT
LTLEIKKPVSAVDRLSSLIMSSGCESSSKLEASRASPEERNHTDTTQIPSSENANVKQAA
TTHSMPVTNIDDVVSELNSAESEVKDQSAEEYSKEDDRGTGAPSQPNPLDFSALDMGNGT
CHFPLGKTFLNSYSRNFSNLGESIVPLQKGDGHKPSMYSMVDSDSESDSTDSAVKIEKSQ
GHSEGPRDTDTDEEEVELCFSTVSQSAFSQSEGSSLPDGNGCATRQSVDQPGAKLLTSTD
LHKPSSVSAQDRDPQDPICHEDSGKDLLNGKIGHAPTQQEAVCVSKTTQSNCSDDEKCET
MSKSFQTCQTPTDTPVTQNNCHVTPRSQDRTARLLSEASRSAEKLNTGQAPLKLTVSEPN
ASHYANGKSSGQASLALASKEKEKVLSTLDLKSTFSQNQSKSATSVRSLGTKSSNDSPVS
PLLRGRLKVDDKKSNTSSKLKGLSIKSKCKDQEQPVSRSPRAESPVQRKSLVSPSQSPKL
HSKRTTPTGSPKSTRSSEKSRVSCCKTDQNQLTVSTNSKVNPINTAKEELKPLKKEDALD
LKQQVSKPEVTVGNTQRTFIEVRLSSSSSSTPVLARKEVVNASHLSLASLSVDSIKWKES
NSDFSLGSHTIPLESVNSSSSSAQQNGDNKANETAEKVFCNGQEESLLRNSTNKDAASNL
KTSKSKLYLRGLDRRSCSTDAGGSLDTNPFSVRQRIQSFESLASFDRSVIKCIDIPFYAV
NSKPTLNRRLSGYAGSVSSQSIDSRSLRRSFSSCVDNLSSTPSLQNWSTSSTATNCESTP
SNQTTETVMKEMKNETSQNQPTVHTPPVLRSRNARAHGGLSRSKLREIKALSMPELDKLC
TEDFTSDPGNVIFKTELEINPRRSIDPSSQCTVVTRVSSVDLGALGSTSNGEHHEIQDTG
LSCWSISLKDLEFSPLDQNKVNDVLCSLPTKVDVTSLIQEANATSEVKDDVYFVILTKEQ
GAGLGFSIAGGVDLEQKSITVHRVFTRGVAGVEGTIHRGDRILSINGTSLSGITHGEALS
CLHQTRLPKQALVIIQKDKNAEPTSPRQELSLQTAVCTSPGPRENIRGHKTSVEVGPDGA
LSVELQKTTAGLGFSLDGGKASAHGDRPLYIKRIFRGGAAEQSRVIDVGDELLAINGRSL
QGLMHYDAWNIIKSVSEGPVQLVIRKPRTSV
Download sequence
Identical sequences ENSDARP00000077950 ENSDARP00000077950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]