SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000079812 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000079812
Domain Number 1 Region: 193-551
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-116
Family Motor proteins 0.0000000000851
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000079812
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0562
Family Tudor domain 0.026
Further Details:      
 
Domain Number - Region: 118-144
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0915
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000079812   Gene: ENSDARG00000043571   Transcript: ENSDART00000085377
Sequence length 704
Comment pep:novel chromosome:Zv9:8:13441358:13464125:1 gene:ENSDARG00000043571 transcript:ENSDART00000085377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAVNFGRIVVGIYVEIKRSDGRIHQAMVTSLNEDNESVTVEWIENGDTKGKEIDLECIF
SLNPDVAPEEEISLSPVTPPPPTPSSVKVNKIPKNRRTIAPGRSEIPSRDNRVGSTRAPP
PAQQPSQPTQSQTQSQLTQQQQQNVIYSPSARRKSNCVKEVEKLQEKRERRRLQQQELRE
KRAQEVDTTIPNYEILQMIRDFRGSLDYRPLTTTDLIEEHRICVCVRKRPLNKKELSVKD
LDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSTTNEMVYRFTARPLVETIF
DRGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLDLQV
YATFFEIYSGKVFDLLNRKAKLRVLEDGKQQVQVVGLQEREVKCTEDVLKLIEIGNSCRT
SGQTSANAHSSRSHAVFQIILRRKGKMHGKFSLIDLAGNERGADTSSADRQTRLEGAEIN
KSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLN
TLRYANRVKELTVDPNAVTEGIRPNVNAINQLDIMDEEWELGNSPQRDDLKLLCEQNEEE
VSPQLFTFHEVVSQLVDMEEQVLEDHRAVFQESIRWLEDEKVLLEMTEEVDYDVDSYSSQ
LEQILDQKIEILIELRDKVRSFRSALQEEEQASKQINPKRPRAL
Download sequence
Identical sequences ENSDARP00000079812 ENSDARP00000079812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]