SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000080366 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000080366
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.43e-82
Family BAR domain 0.0008
Further Details:      
 
Domain Number 2 Region: 400-515
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00014
Further Details:      
 
Domain Number 3 Region: 235-361
Classification Level Classification E-value
Superfamily PH domain-like 5.79e-28
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 641-759
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.71e-25
Family Ankyrin repeat 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000080366   Gene: ENSDARG00000060783   Transcript: ENSDART00000085931
Sequence length 802
Comment pep:known chromosome:Zv9:22:40718184:40781832:-1 gene:ENSDARG00000060783 transcript:ENSDART00000085931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITVDFEECLKDSPRFRATIEEVEGDVCELESKLDKLVKLCIGMIDAGKAYNTANKQFV
SGIRELAQQSATDDVIESSLSTFAENLQEMINYHTILFDQAQRSIKSQLQTFIREDLRKF
KEAKKQFDKVSEEKEAALSKNAQAPRNKAHEVEEASNILNATRKCFRHIVLDYVLQINVL
QSKRRSEILKSMLSFMYAHLTFFHQGYDLFSELQPLMKQLTGQLDQLVLDATKERKDMET
KHSTIQQKEFSNDDTKLEYNVDAENGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMMQADSEKLRQAWIKAVQNSI
ATAFRDKADDAEKMDRKSSTSTGSLDSAGDVKEKCVKGENALQRVMAISGNSSCCDCGQP
EPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNGVINQIYE
ARREELGARKPNAGDPRHEVEAYIKAKYVERRFVQRRSEDEIRQKVLLLSKEDKHPSGCS
DTQTTRSVSKPRLASSSSVHLESLFCVDELDSLFSYFTSSGQTRCLRSSDGEAQTLTEES
RETVNASASTSTVNHTDEEGCCGKAVVVFCEPQQATAGLQLYWASFSRSLPDMAEALAHG
AQVNWTNTEQDNRTPLIMAVHGGSLVTCEFLLQNSASVNQLDSWGRGPLHHATILGHTGQ
VCLFLKRGANQNAADVENQTPLSIAVEAANADIVTLLRLAKMNEEMRESEGPYSQSGDET
YQDIFQDFTQMASNDPDKLNRY
Download sequence
Identical sequences F1Q973
ENSDARP00000080366 ENSDARP00000080366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]