SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082910 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082910
Domain Number 1 Region: 216-466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-59
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 90-187
Classification Level Classification E-value
Superfamily POZ domain 1.67e-25
Family Tetramerization domain of potassium channels 0.00000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082910   Gene: ENSDARG00000061753   Transcript: ENSDART00000088477
Sequence length 545
Comment pep:novel chromosome:Zv9:4:59850835:59852472:-1 gene:ENSDARG00000061753 transcript:ENSDART00000088477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNGLEMEIALVSFEKRGDGESYQNQNSLDHPRLVHNKEVFPRSPQQSSWKMNDMNSTIM
GSTENTVDYYSPHLFEEDILDMDLDHENNERVLINIAGLRFETQLGTLNQFPDTLLGDPD
KRIKYFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYQLGEEAM
DRFREDEGFIKEEEKPLPQNEFQKQVWLIFEYPESSSPARGIAIVSVIVITISIITFCLE
TLPEFRDERELPVTSRAVNGTQERPSLTFTDPFFIIETTCVIWFTFELFVRFFACPSKSE
FSKTIMNIIDIMSIMPYFITVGTELAEQQGQEHNNGQQAMSLAILRVIRLVRVFRIFKLS
RHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVFFAEADEPESHFSSIPDAFWWA
VVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQDQASL
RDEPNNGGTSNQSDDLHGLRKSSKDVERNEDSNTPVEKSNTKANSRMDIKRSLYAFCLDT
RETDL
Download sequence
Identical sequences ENSDARP00000082910 ENSDARP00000082910 XP_021330984.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]