SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000083499 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000083499
Domain Number 1 Region: 617-799
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.41e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0017
Further Details:      
 
Domain Number 2 Region: 777-894
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.54e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 3 Region: 34-147
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000083499
Domain Number - Region: 470-531
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000083499   Gene: ENSDARG00000061986   Transcript: ENSDART00000089066
Sequence length 946
Comment pep:known chromosome:Zv9:25:26456513:26512149:-1 gene:ENSDARG00000061986 transcript:ENSDART00000089066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEEDESSANTSRNSRILTAKSFDVADCDGKKGQASKLCGYLNKLTGKGPLRGFKTRWFV
YDPRKCFLYYFKTPQDALPIGHIEIGDACFSYDVEAEEGLFEIHTEGKEFLLKAPNRQVM
RYWLQQLQQKRWEFCNMPGPRDSWCSPTPLYPHTGLVARDAEAMPYEKPSESMESVRNDF
ALELDNDGLIGHQTAHVPVAQPTAALSSLRQWGSEIRNSMSHLRPGRAGENRRSVFYTGG
SEDWEMVDPPTKDPAPSDCQHRESSSHFNRSSIGSAFTFDFRNPSKIKRPFHSGSGKPNH
SAESSPVEYNETKISKLQLRIQSQQEEISQLQEQENKLREELGSQKELVRLLQKTLRSAQ
CDWPSTVGPHNHYLEENEVDKALTERDTQIKDLCSHMEKLALEKESLQQELKGLKIKVGE
INEQLGMLMETIQAKDEVIMKLSQPSGEGETQSAECNSPSVTREQQELNTLKDSLQGYKS
QNKFLNKEIIELTVLRRNAESREKLLEAKYNSLEAKLCQVESKYLVLLQEVKSPVCSSSE
QTHSGDVITRLLEDALQVESTDQQEHPVLKPNAVSEYDIYGFKTVPEEEDEEEKLEAKKR
ALDLKSLSLTDQETSVRVKWDNYLAITMNREMVRSPDLKALMRGGVPHIHRSKVWSWCVS
FHVKKMRDCQPKDYYHNLLCMANDKPNPACKQIELDLLRTLPNNKHYSSPDSDGIQKLRN
VLLAFSWRNPDIGYCQGLNRLAAIALLYLDQEDAFWCLVAIVEVFMPHDYYTKTLLGSQV
DQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFLVVFVDSVVSDILFKIWDSFLYEGP
KIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMAFVDMNPFPLRQI
QNRRTFHLEKVRLELTELEAIRQTFLRERESTMDGRTLISDDEEES
Download sequence
Identical sequences E7FB23
ENSDARP00000083499 XP_002666912.2.45394 ENSDARP00000083499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]