SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000083977 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000083977
Domain Number 1 Region: 456-552
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.81e-21
Family PWWP domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000083977   Gene: ENSDARG00000073817   Transcript: ENSDART00000089544
Sequence length 565
Comment pep:known chromosome:Zv9:13:53150536:53161101:1 gene:ENSDARG00000073817 transcript:ENSDART00000089544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EELRAGSRLPVTVEQILNDTLVVTLRYREKSFTGILLDCSRKTGLFCLPDVVGKTEEPLI
LRPDCEVLSEESSSEPVSQPTQRPKDENTEPEESPAPVPIPLQPGQHTYPPYFEGAPFPQ
PIWVRHTYNQWVPQPPPRPIKRKKRRSRDAGRLAISTIRLRPRQVLCEKCKNTLNSDEDS
KDGPTLPKTSRKENSPHAEDDNTKTTSAKSKRFRKDKKEEEKFPSGDVIPHSPVIKISYS
TPQGKGEVMKIPSRVHGSVKPFCPKQLLQNGHGDRDSSKETPKKLQPPMDAIRTGLTISI
PKLKLPKLPSPDAQSPKIRLRSRAEGAEQMSVYEAELVDGARRRSPRVPNSGLPQSEDAE
ELWSGSCGGEVERHGDLTLLINFRKRKADSSSLSVCSSDSLDESKSFSSDGTSPELCDLA
PGDDISVSSSSQGEGKTVPPLTVRLHTRSMSKCVTEDGHAVTVGDVVWGKIHGFPWWPAR
ILSISGTRREDGEVDAPWPEAKVSWFGSPTTSELSVAKLSPFREFFRSRFNRKKKGMYRR
AIMEAAKAVGHMGAEITSLLAHCET
Download sequence
Identical sequences ENSDARP00000083977 ENSDARP00000083977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]