SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000085044 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000085044
Domain Number 1 Region: 11-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.31e-79
Family BAR domain 0.0000000172
Further Details:      
 
Domain Number 2 Region: 268-342
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-24
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000085044   Gene: ENSDARG00000023600   Transcript: ENSDART00000090611
Sequence length 347
Comment pep:known chromosome:Zv9:1:25706787:25748642:-1 gene:ENSDARG00000023600 transcript:ENSDART00000090611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQRVSEKVGGAEGTKLDVDFTEMEKKVDTTSRAVLDILTKTTEYLQP
NPATRAKMSMMSSMSKIRGGDKGPGYTQTETTLGEAMQKAGRELGEESCFGVALIDVGEA
MRELGEVKDALDMEVKQNFIDPLQNIHDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKVTE
DEIKQALEKFDDSKEIAEQSMFNLLENDIEQVSQLSALVQAQVNYHRQAAEILQQLSSKI
EDRIREASCKPKREYVPKPRTSLDFSENHNGSIGHSGPSRSPAPMDQPCCRALYDFDPEN
EGELGFKEGDIITLTSKIDDNWYEGMVNGQSGFFPVNYVDILVALPH
Download sequence
Identical sequences Q803T6
ENSDARP00000085044 7955.ENSDARP00000085044 NP_957410.1.45394 ENSDARP00000085044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]