SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000085731 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000085731
Domain Number 1 Region: 1031-1227
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000248
Further Details:      
 
Domain Number 2 Region: 817-940
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-29
Family Pleckstrin-homology domain (PH domain) 0.00000893
Further Details:      
 
Domain Number 3 Region: 36-161
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-18
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000085731   Gene: ENSDARG00000075673   Transcript: ENSDART00000091298
Sequence length 1793
Comment pep:known chromosome:Zv9:2:12099800:12197198:1 gene:ENSDARG00000075673 transcript:ENSDART00000091298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMASHWRNSGDEDELIYSGGLPHCEDVVDQDDSSGVPFHVEDEPFSWPGPKILRLRRTSQ
GFGFTLRHFIVYPPESAMHSNFKDEDHSHRGRPRNRLEPMDTIFVKQVKEGGPAHSAGLC
TGDRIVKVNGESIIGKTYSQVIGLIQNSHTFLELCVMPKDEDILQLAYSQDAYLKGHDAY
SGNARHIPEPPPICYPRVDCKPPGMAQATETSAPGVVSSDLGYRVEIPVPPSPPPPIPKT
QTAVCVCNESVRTVVVPPDVHMGLMVQGHRGDYGLVGPDPMLIRARPGTVSGGRPPYLHP
RKADMFPSGYHGDPYAIPPTHYVPASSITSPATHQNIDWRTYQTYREYIDNKGIHAYSRT
VQERLDSLRAASQSTHGGPHCGPQPGWGNKLRRRSTSHDRAYQGPSMLPPRSASQDRMSG
AERAAHARDWPPRSVSSDGLIRKPRAHSSDYVEHGELVSAAPWAAPVDRQLYSRVDQRSR
PSRQSLPPRAVLYRPPTGYGMSVRGNAGSHKHSSRTDIPPTAGFPERPRNGINQAKEPPS
KDQSGTVVGNRILNSASNQSRTRAETMQSPESGKDISVGYRSASYSAPPLQRPKGGASTQ
RTSSRDVKGLPVNGSSPVEGVVLREKPPTGKGTPQPLRHPSYILAVNDTDGSEPAGGGVC
WLPNDARREMRMQRLGERLDSSFCSSNLDESLDSIPFIDEPASPSVDHDGSHIPASVVIS
GAQAALSDSPSPSTPSPLMRRQLSHDQESLRNAILESGTKTERSKSYDEGLDNYREEGRG
RSSKPSLRVFRKALDGHKSDDSSSRRDSSTEIFSDSTKEGWLHFRQLNTEKGKRVGGGMR
PWKQMYAVLRGHSLYLYKDKKEGLAHVNSQLEDDPQSISIKACLIDISYSDTKRKNVLRL
TTSDCEYLFQAEGREDMLSWIRVIQENSNLDEENAAVTSTDLINRKLKEYISMSAPSSKT
EPSPKTSRQSLSIRQTLLGGSSKSQSPYSPKNEQDRSKDDSSPPRDKAAWRRGIPGLKKK
PQDKRPAAGVTFGVRLDNCPPAQTNKFVPLIVEVCCKLVEDRGLEYTGIYRVPGNNAAIS
SMQEELDTKGMTDIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNEKYSNFIDANRMEDP
VERLKALKRLIHELPDHHYETLKFLSGHLKTVSENCEKNKMEPRNLAIVFGPTLVRTSED
NMTHMVTHMPDQYKIVETLIQQYDWFFTEDGDEEPTTTVEQESTVQSQPVPNIDHLLTNI
GRTAPSPGDVSDSTTSDSAKSKQGSWGTGKDQYSSELLRTSIFASRKRKKPKDKPQPSSS
DDDLDASFSKKDLPVQNDPNWPADDQTEDAESEVGLDDQRTEDDDQSPGDGLDLTSENKQ
LITEHLPQQTCPSSKINTSPKPSYHMTRQSSLSDHPSNYDDGCVSDLGTLNSTSSQASVP
RIRHGRTTGHWMESAGMGLGAEVCSITSDYSTTSSMTFHTGVESIALSPEVQSVAESRGD
DADDERSELISEGRPMETDSESDLSVFAVGRDGVPAEDSSQLGGSVTPLQDVPSLIPSHR
IIACDTLARKRGSRQKTDSESSADGSRSDKESTRISRVLEAVKGRSTGSLSSSSRSESER
AEPMWRIKITDRLKCRLRTSADDMFGVGSQRTRSPETRSKRKSNIRRRHTMGGQRDFAEL
SVIGDWQRVEGNELSAMDRLKPKCSSQDFSIRDWIARERHRTSNPEVSLDVLDLHSSRSR
DLLSAGPSHSYLGQHLNGDVAVAQGKSLSLGADAHPHKLSGAQVVRSRFYQYL
Download sequence
Identical sequences F1QST2
ENSDARP00000085731 XP_001918968.3.45394 ENSDARP00000085731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]