SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000086957 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000086957
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-81
Family BAR domain 0.00053
Further Details:      
 
Domain Number 2 Region: 394-511
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.71e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00019
Further Details:      
 
Domain Number 3 Region: 235-361
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-27
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 4 Region: 596-717
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-22
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000086957   Gene: ENSDARG00000056478   Transcript: ENSDART00000092525
Sequence length 735
Comment pep:known_by_projection chromosome:Zv9:2:5530274:5565810:1 gene:ENSDARG00000056478 transcript:ENSDART00000092525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTVDFEECLKDSPRFRATIEDVEEDFGELESKLDKLVKLCIGMIDAGRVYNQANKQFV
NGIRDLALQSTRDEVIGSSLAAFSETLQEMNNYHTILFDQAQRSIRSQLQTFVKEDLRKF
KDAKKQFDKVSEEKEVALVKNAQVPRNKLHEVEEATNILTTTQKFFRNIALDYVLQINVL
QSKRRLEILKSMLAYMNANLTFFNQGHDLFSQLQPLMKQLSGQLDQLVVDSAKEKRDMEQ
KHSSIQQKDFSTEDSKLEYNIDTDNGIAMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQK
RFRDNPTVVVEDLRLCTVKHCEDVERRFCFEVLSPSKSCMMQADSEKLRQAWIKAVQSSI
ASAYRENSLDRQSSASLGSLDSGCESVKLVKGESALQRVLAIPGNEFCCDCGQSDPRWAS
INLCITLCIECSGIHSRSLGVHNSKVRSLTLDTWEPELLKLMCELGNDVINQIYEAHREE
NGGKKPQPGDPRREIEAFIRAKYVDKRFVLKPTEQEQMEKIMTLRKHDKRMQGLNYVVVM
AVKRADSGIQNSADGSREMLASTPSSSSLSETESEAAANQAERSPVFSKLTNFSADSLLY
WASCACSLKDMAQALAHGADINWVNLEDSSRTPLIQAVQGGSLISCEFLLQNAACVDQQD
IRGRGPLHHATILGHTGQVCLFLKRGAKQNTVDTDSRSPLSIAVEAANADIVTLLRLAKM
NEEMRGSEGAFGQAG
Download sequence
Identical sequences ENSDARP00000086957 ENSDARP00000086957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]