SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088414 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088414
Domain Number 1 Region: 608-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-79
Family Protein kinases, catalytic subunit 0.000000000875
Further Details:      
 
Domain Number 2 Region: 25-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.59e-65
Family Ephrin receptor ligand binding domain 0.000000657
Further Details:      
 
Domain Number 3 Region: 326-529
Classification Level Classification E-value
Superfamily Fibronectin type III 6.95e-35
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 4 Region: 903-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.46e-20
Family SAM (sterile alpha motif) domain 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000088414
Domain Number - Region: 247-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000267
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088414   Gene: ENSDARG00000027112   Transcript: ENSDART00000097644
Sequence length 976
Comment pep:known chromosome:Zv9:23:44476384:44527744:1 gene:ENSDARG00000027112 transcript:ENSDART00000097644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRVCWIMALSWFWMVSTGLVSAEEEVLMNTKLETSDLRWTIYPSGDPEWEEMSGLDEEG
NSVRTFQVCPMDSSVSHWLRTRFIPRHGASQVYVEIRFTMMECSAMPASFRTCKETFNLY
YYQSDEDTASATHPAWMENPYSKVDTVAADFLLRRGGERKSNVKTVRVGPLSKKGFYLAF
QTQGACMALLSVRVFFKKCPAVSRAFSSFPETLPHSLVQQAEGVCVDNSAPTGQSTAPPT
MFCGEDGQWVGPPSSTCACKPGYEPVDSDRCRACGLGQYKASVGGSLCRVCPDNSNTHFA
GSSLCVCRPGYHRATSDLPDSACTKPPSAPRSIIYQINDTVVTLEWSEPLDRGGRSDLSY
SVECMHCRGSLCVQCADSITYRPGQMGVPGRRVIIRGLLPHTTYTFTVLAQNGVSAVSHT
SPASSSVNITTSRDVAVPVSGIRRIKASESSVSISWTVPPQTQHSIQDYQLRYSLKGQDD
GWQYVSSRSSSVVLNDLSRASQYQVQVRARTAAGYGHFSSAVSISTLPDDEESPSRLMLT
GVLVAIGLLILIAVVIVAVFCFRRSTRRRDPDPDKSGQFLMGQGIKVYIDPFTYEDPNEA
VREFAKEIDVSFVKIEEVIGAGEFGEVCRGRLKVPGKKENYVAIKTLKGGYTDKQRRDFL
SEASIMGQFQHPNIIHLEGVITASCPVMILTEYMENGALDSFLRLNDGQFTPIQLVGMLR
GIASGMKYLSEMSFVHRDLAARNILVNSNLVCKVSDFGLSRFLTENSSDPTYTSSLGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPP
PECPASLHQLMLDCWQKERSSRPRFCAIVSALDRLIRNPASLKITGRIPDGPSHPLLDQR
APPPLSHCSSVADWLRAIKMERYEDAFMQAGFTAIQHITHISTEDLLRIGVTLAGHQKKI
LSSVQTLRIHGGSLRY
Download sequence
Identical sequences F1QR66
ENSDARP00000088414 ENSDARP00000088414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]