SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088944 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088944
Domain Number 1 Region: 18-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.19e-70
Family BAR domain 0.0005
Further Details:      
 
Domain Number 2 Region: 286-372
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-16
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088944   Gene: ENSDARG00000035470   Transcript: ENSDART00000098172
Sequence length 373
Comment pep:known chromosome:Zv9:5:33282075:33327526:-1 gene:ENSDARG00000035470 transcript:ENSDART00000098172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNVKKLASDAGVFFTRAVQYTEEKLGQAEKTELDAHLENLIARADCTKNWTEKIFRQT
EVLLQPNPSARIEEFFYEKLDKKIPSRITNAELLGQYMQDAAKDFGPGSPYGSTLITVGE
YQKRLGGSEREFLQTSAINFLTPLRNFLEGDWKTISRERRLLENRRLDLDVCKARLKKAK
LAEAKAAAEHELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVEAQAAYYAQCHR
HMQDLQKELSSANGDTFPNAFAVNASTSGVSAGPSPLSTGTQPGPSSPSRPPNPPNALES
NTLKIEEVKPPATGTRKAKVLYDYDAADTSELSLLADELITVYTVPGMDPDWLIGERGNQ
KGKVPVTYLELLS
Download sequence
Identical sequences Q802U5
NP_957413.1.45394 ENSDARP00000088944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]