SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088987 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088987
Domain Number 1 Region: 318-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-46
Family SPRY domain 0.0000483
Further Details:      
 
Domain Number 2 Region: 6-71
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-16
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Domain Number 3 Region: 132-169
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000275
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088987   Gene: ENSDARG00000051804   Transcript: ENSDART00000098215
Sequence length 500
Comment pep:novel chromosome:Zv9:7:76703399:76705152:-1 gene:ENSDARG00000051804 transcript:ENSDART00000098215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLTVGDVSRHLLCPVCKTLLEEPVSISCGHTFCKRCLDESLSESQCPLCQEPVSTKPSV
NEAIEALLQEFRQTLPPNPDLFSGEIDAVPCDICEKDFTYKAIKSCLTCLLSYCDKHLKQ
HQSKARFKNHTLVNAVKDLDKRSCTEYGRALELYCRRNECCICALCVKTDDDVIPVKSER
KIREVRTCTPMIPIELVIEPCAEGIISANYAIIIRGHRITACASVTPAMTNNTSACIAKH
RNPIEEMKMKIKKREDKLKELKESAEKCQVSTVHLCEVLITEIGRIQRFAGMCTNHFSMM
NVHLAHPVMGNLLYFFDTVDIILDTETAHPDLEVSTNGKAVRDSGRNSGKSRGLNRFDQD
GGILGKSSITSGRAFWMVDVGRKVGWQLGVMREGANMKGKISYKPSKGYWVIVLCGSNMY
GAFEDPPIMLQLSSNPQKLGVYVDCEAALVSFYDMEAQTHIYTYRECRFNGAIRPYFNPH
VNRDGNNGSPLVICDVKHSD
Download sequence
Identical sequences ENSDARP00000088987 ENSDARP00000088987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]