SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089069 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089069
Domain Number 1 Region: 390-521
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 552-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000063
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 521-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 360-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000029
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000089069
Domain Number - Region: 586-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089069   Gene: ENSDARG00000068104   Transcript: ENSDART00000098297
Sequence length 783
Comment pep:novel chromosome:Zv9:18:33614468:33734412:-1 gene:ENSDARG00000068104 transcript:ENSDART00000098297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVFTPCLHDGQMDSVKKASPSKTRLISAHRTSAQMSAMRLDRDRKSWHSWESSSSDRRS
AVRAMIRDVKRGLHWTVICLFSLALRPQVVCAVGTFEVQIRQWQNPQGILQSGQCCDPQS
SGGQRCSSGDQCETFFKACLKEYQARVAPTGTCTYGTGSTPVLGGNSHSLHHHGNEGSDS
RNGRIVIPFKYAWTKSFSLVIEALDHDNETSEAGREELIERVLLSSMLNPGEQWQSFRHH
GRTFTLEYRLRFRCDANYYGPLCNKLCRARDDFFGHFDCDASGIKVCKEGWTGAECRQAV
CKQGCHLDHGSCDLPGECKCHYGWKGDLCDECETFPGCDHGTCTEPWKCVCDTNWGGLLC
DKDLNYCGNHQPCKNGGTCTNTEPNEYLCVCQEGFRGRNCDIVENACLSAPCENGGTCVE
DPSGFSCRCSPGWTGPSCASAVQQCDSSPCGRGATCQETPEGFQCLCPPFWTGRTCQLDT
NECETGVCVNARSCRNLIGGYLCDCLPGWSGPNCDIWNSSCRGLCLNGGHCKDSQCVCLP
GFSGKLCQIAVNACDSNTCVNGGQCVERQGGTGLLCRCPLGYTGTHCETELDLCNPNPCP
KEMPCLSTGGGYKCVCPEGYFGNECLNLKDPCHEPHCQGAVSDPNASGFSVYMVLVGVFA
LLVAGSCSVCALLLSRLHHRHRTKEQLRTSAPDDNAINNQRQFCTLIRNLDHSVAILPPA
QTVPTSVPTVPMRCSEEIELTFPPSPAPSPALKPAHGPKLDICNREREKLNRFHYAESQE
LEV
Download sequence
Identical sequences E7F4G3
ENSDARP00000089069 XP_003200521.2.45394 ENSDARP00000089069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]