SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090251 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090251
Domain Number 1 Region: 216-463
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-66
Family Nuclear receptor ligand-binding domain 0.00000000594
Further Details:      
 
Domain Number 2 Region: 14-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.38e-31
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090251   Gene: ENSDARG00000001910   Transcript: ENSDART00000099477
Sequence length 492
Comment pep:known chromosome:Zv9:7:30875147:30908063:-1 gene:ENSDARG00000001910 transcript:ENSDART00000099477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLMITAMKAQIESIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQGTVSYSCPRQKSCL
IDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLFAEVQKHRQQQQDDKTGDES
EKNQESQAPGEAEPLTPSYALSSSGVTEIPDDLSGYVNGQTQEEGKADSAIGGFYLDIQP
SPDQSGLDMDGIKLEPVCDLSSDSGLDQYCCYSNGDASPPHDDLEHLSENICKSHLETCQ
YLREELQPSNWQTVLQSNLEAYQKKSQEDMWQLCAVKVTEAVQYVVEFAKRIDGFMELCQ
NDQIVLLKAGSLEVVFVRMCRAYNSQNNTVFFDSKYAGPEVFKALGCDDLISSVFEFAKS
LNSLQLSEDEIGLFSAYVLMSADRSWLQEKTRVEKLQQKIKIALQNLLQKNKRDEGILTK
LVCKVSTVRMLCRRHMEKLSAFRALYPEMVHTRFPPLYKELFGSDFEQILPQFMYTAFSQ
SSPATLCPNGTV
Download sequence
Identical sequences B0JZJ5
ENSDARP00000090251 ENSDARP00000090251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]