SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000091257 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000091257
Domain Number 1 Region: 229-468
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-65
Family Nuclear receptor ligand-binding domain 0.0000000403
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000091257   Gene: ENSDARG00000057231   Transcript: ENSDART00000100484
Sequence length 480
Comment pep:known chromosome:Zv9:8:19410368:19418167:-1 gene:ENSDARG00000057231 transcript:ENSDART00000100484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNAMYSCSRQRNCIIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQERAGGLGNGISSHTGD
EAGENGNGHSRAYSRGSSTTLSDLDDITTLPDGLLFDLPLTPEEAADYCSLELLGGSSGN
SSSSQSSPESNRQEFGDVTHIKHEYMSPHESGLFTRSILNPPEGCSLMEIERITQNVIKS
HIETSQYSTEELKRLAWTLYTPEEIRVYQNKPTEMLWQQCAVQLTNAIQYVVEFAKRISG
FMDLSQNDQIILLKAGCLDVLLIRMCRAYNPINNTLLFDGKFASPQLFKALVGCDDLVSA
VFEMAKTLSRLQLSEEEMALFTATVLLSPDRPWLTDAQKVQKLQEKVYVALQHYLHKSGV
HEEKLAKMVSKLPMMKSICNLHIDKLEFFRLLHPETAYNFPALYREVFCSEITFPDSTEG
Download sequence
Identical sequences ENSDARP00000091257 ENSDARP00000091257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]