SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092779 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092779
Domain Number 1 Region: 234-483
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-73
Family Protein kinases, catalytic subunit 0.0000000258
Further Details:      
 
Domain Number 2 Region: 102-225
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-32
Family SH2 domain 0.0000477
Further Details:      
 
Domain Number 3 Region: 40-131
Classification Level Classification E-value
Superfamily SH3-domain 1.63e-18
Family SH3-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092779   Gene: ENSDARG00000015068   Transcript: ENSDART00000102003
Sequence length 489
Comment pep:known_by_projection chromosome:Zv9:23:44231273:44259704:-1 gene:ENSDARG00000015068 transcript:ENSDART00000102003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSARTAVNMIHSNQSIHSIFCCCCCALQTSSTHVDMNNRYPGSVYTAQISQKKLPRSPP
DDDDNGVMKVVAMYDFTARESSDLTLHRGETYIILHKQDQLWWRAKDRHGNKGFIPSNYV
TETGTIEANDWYCKNINRAEAEHLLRQEGKDGGFVVRSSSQPSTYTVSVYTHCSGKGEVR
HYQIKRTDEDKFYLAENHVFISIPELINYHKYNAAGLVARLRYPIGPKGKCQPATAGFSS
DKMEINPSELTFMKELGSGQFGVVRLGKWRAQHKVAIKTIREGAMNEDDFIEEAKIMTRL
CHPKLVQLYGVCVTQRPICIVTEFMENGCLLHFLRQHSKTLGRSQMLCMCQDVCEGMEYL
EHNQFIHRDLAARNCLVNERNVVKVCDFGMTRYVLDNQYTSSMGSRFPVKWSPPEVLHFN
KFSNKSDVWSFGVLMWEVFSEGKTPFDNRTNVEVVEEVTQGSRLYRPHLATPHIYNIMYR
CWHEVTHTH
Download sequence
Identical sequences ENSDARP00000092779 ENSDARP00000092779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]