SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093171 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093171
Domain Number 1 Region: 249-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-81
Family Protein kinases, catalytic subunit 0.000000000679
Further Details:      
 
Domain Number 2 Region: 110-238
Classification Level Classification E-value
Superfamily SH2 domain 1.43e-40
Family SH2 domain 0.00000641
Further Details:      
 
Domain Number 3 Region: 54-141
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-22
Family SH3-domain 0.0000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093171   Gene: ENSDARG00000004378   Transcript: ENSDART00000102394
Sequence length 525
Comment pep:known chromosome:Zv9:19:45153193:45186846:-1 gene:ENSDARG00000004378 transcript:ENSDART00000102394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCACCKQRKASKAVSNQNSCDAFNGTQASEPSRYIPDPTFNSGIPNFNDFSNPLTPPTS
IINPARPPGLTGGGVTLFIALYEYDARTEDDLSFQKGEKFHIINNTEGDWWEARSLDTGK
SGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLAQNNPRGTFLIRESETTKGAYSLSI
RDWDDAKGDHVKHYKIRKLDNGGYYITTRTQFDTVQQLVEHYTGSNDGLCCYLTKACPNT
TPQTMGLGRDAWEIARDTLKLNRKLGQGCFGDVWMGMWNGTTKVAVKTLKPGTMSPEAFL
DEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSLLDFLKDGDGRNLKLPQLVDMAA
QIAAGMAYIERMNYIHRDLRAANILVGDGLVCKIADFGLARLIEDNEYTARQGAKFPIKW
TAPEAALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQGSP
ASLHELMLQCWRKDPDERHTFEYLQSFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences Q8AWF1
NP_997946.1.45394 ENSDARP00000093171 ENSDARP00000122444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]