SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093172 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093172
Domain Number 1 Region: 249-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-82
Family Protein kinases, catalytic subunit 0.000000000706
Further Details:      
 
Domain Number 2 Region: 105-227,255-282
Classification Level Classification E-value
Superfamily SH2 domain 2.67e-40
Family SH2 domain 0.00000543
Further Details:      
 
Domain Number 3 Region: 61-114
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000091
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093172   Gene: ENSDARG00000004378   Transcript: ENSDART00000102395
Sequence length 528
Comment pep:novel chromosome:Zv9:19:45151187:45186846:-1 gene:ENSDARG00000004378 transcript:ENSDART00000102395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCACCKQRKASKAVSNQNSCDAFNGTQASEPSRYIPDPTFNSGIPNFNDFSNPLTPPTS
IINPARPPGLTGGGVTLFIALYEYDARTEDDLSFQKGEKFHIINNTEGDWWEARSLDTGK
SGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLAQNNPRGTFLIRESETTKGAYSLSI
RDWDDAKGDHVKHYKIRKLDNGGYYITTRTQFDTVQQLVEHYTERAAGLCCRLIGSCRRG
MPKLADLSVKTKDVWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPE
AFLDEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSLLDFLKDGDGRNLKLPQLVD
MAAQIAAGMAYIERMNYIHRDLRAANILVGDGLVCKIADFGLARLIEDNEYTARQGAKFP
IKWTAPEAALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQ
GSPASLHELMLQCWRKDPDERHTFEYLQSFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences A5WWJ6
7955.ENSDARP00000093172 ENSDARP00000093172 ENSDARP00000121344 ENSDARP00000093172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]