SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093559 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093559
Domain Number 1 Region: 408-478,519-555
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-18
Family Second domain of FERM 0.0072
Further Details:      
 
Domain Number 2 Region: 6-109
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000401
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 3 Region: 311-401
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000192
Family Ras-binding domain, RBD 0.096
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000093559
Domain Number - Region: 559-625
Classification Level Classification E-value
Superfamily PH domain-like 0.00174
Family Pleckstrin-homology domain (PH domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093559   Gene: ENSDARG00000070174   Transcript: ENSDART00000102784
Sequence length 634
Comment pep:known_by_projection chromosome:Zv9:3:37013520:37040963:1 gene:ENSDARG00000070174 transcript:ENSDART00000102784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDPEVVVKGWLLREVQGGWLRQRRFWFVLTSDSLDYYSGPDRDARRLGTLVLTSLCSV
LWPDKHTYKQTGYWSLTVYGRKHCYRLFTKHYNEAVHWACAVQKVIDSKAPVETPTQLLI
RDIEENKFNPEVVEHIYQHNPILRYTQSPLYAPLLPFPYGSLHHTHMASKGYTSIREEAV
RLFNCLQQLESAREPIPLIQGILQTCLDLRPLRDELYCQLIKQTSTTSSRVQTQTNPNPQ
LRYWQLLTCMSCTFLPSCGILRYLRFHLKRVQSLSVDPEVESYASFIGQALEKTRGRECV
PSWEEIQGLMGRQEILCTVHYPGPGCCQIPITSHTTANEVVRKMAERLGLQDSRNTFGLF
EQNACWEKAIGGSTIIADVITRFENLSAKDPDSDCQCRLCFKLYCLLDTENISTDSIEYL
FLYEQCHEMVVRGQLPACEEDLLSLAALRLQYLLGDFSALSPYPALEQLFPAEVVEARAL
LAPVDPPGCPSFPGGLLAGTLWGHKRRQEQDQRLRARLREEGAVVMSTILERWKALVGYS
GRDSMAAYLTIARQWSGFGCTLYEVDFYISSTGSFSQKLWLGVAASCVTLYRQGEAEALE
SLPITQICSYGVSDSNTFRITAGDRDLLFETTKV
Download sequence
Identical sequences ENSDARP00000093559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]