SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094005 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094005
Domain Number 1 Region: 303-412
Classification Level Classification E-value
Superfamily ARID-like 3.79e-34
Family ARID domain 0.00032
Further Details:      
 
Domain Number 2 Region: 598-670
Classification Level Classification E-value
Superfamily Chromo domain-like 1.3e-17
Family Chromo barrel domain 0.015
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000373
Family Tudor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000094005
Domain Number - Region: 534-573
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094005   Gene: ENSDARG00000043873   Transcript: ENSDART00000103228
Sequence length 671
Comment pep:known chromosome:Zv9:17:11258143:11281316:-1 gene:ENSDARG00000043873 transcript:ENSDART00000103228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRMVKVKVVLKGDSTSQVVQDDQVKGPL
RVGSTVEVKSPEGGLSEAVISKLTDASWYTVVFDDGDEKTLRRTSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSSQAVAEDEKESSSSEDDDDDKRRLNDDLLGKVAC
VQSEPDDSWLCVLVISPSCNDDLTVKKDQCLVRSFADSKFHTVARKDVKEVNIDTLSKPE
YSLRKGCEAAKLFLQNRQIPDRWKVDLSEILESSSSDEDDEDEDGEGKEGEEEEKEPEPE
EPDDEPDPEERDHFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVHIHGGCDNIES
GSIWKQIYMDLGIPVLNSAASYNVKTAYRKYLYGFEEYCRSAQIQFRTVHHNEPRPDVQP
EVQSIKSVTKESENNDEMMQQVTAEPGTSEDKPAADADESDAESEKGRKDVCSPRGRRRC
LTTPVKVEMEPLKQEKIKEEKKKEDTQSVGENSGEEPKEKSDGEIPGKRRSRRHEESDKD
SEEDDDDNDDEEQDDDDEDDEEEEEDDDDEEEDYFERSRLRERDEREEGDGCEDSEHSLA
GTKVRVKYGKGKTQKIYEANIKNTETDDGEVLYLVHYYGWNVRYDEWVKADRIIWPVDKG
GTKKKQKKKVK
Download sequence
Identical sequences E7FFB4
ENSDARP00000094005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]