SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094283 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094283
Domain Number 1 Region: 541-689
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-62
Family Ankyrin repeat 0.00000422
Further Details:      
 
Domain Number 2 Region: 33-270,302-327
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.84e-58
Family BAR domain 0.0087
Further Details:      
 
Domain Number 3 Region: 419-534
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.5e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000992
Further Details:      
 
Domain Number 4 Region: 304-405
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-20
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 5 Region: 941-1015
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-17
Family SH3-domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094283   Gene: ENSDARG00000002607   Transcript: ENSDART00000103507
Sequence length 1018
Comment pep:novel chromosome:Zv9:11:27409952:27498767:1 gene:ENSDARG00000002607 transcript:ENSDART00000103507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFISVDEFIAETLEDYSSPTTSSFYTKMTSCRNSANNIEEALDSDRTILQKMKKAAKA
KHISGQDHISHLESYINSMEKLAVNFRNNGEQEVASAFNKFAEFSKELLTPMKNLLKSML
HNVNFFLDSLVKGDLKEVKGDLKKPFDKAWRDYENKFTKIEKEKRELAKQYGMVRTEVSG
GEIAEEMEKERRMFQLQMCEYLIKVNEIKTKKGVDLLQNLIKHYHSQCNFFQECLAATEK
LKQYIDALTGQLSAIKHKQDEEKRQLCSLRDQLRPALLPEFKEDSLSRQTVYSMHQLQGN
KQYGTEKSGYLYKRSDGLRKMWQKRKCTVQNCYLTIAHGTPNKSPAKLNLLTCQVKPSLE
DKKCFDLISHNRTYHFLADDECDCVAWISVLTNSKQEALNVALDERRPSGENSVEDLTRA
ITEDIRRMPGNSVCCDCGASDPSWISINLGILTCIECSGIHREMGVHYSRIQSLSLDKLG
TSELLLARNVGNLGFNEIAEANLPSVSVKPSAESDMAVRKDFILSKYMEWQFAQRSGGSL
ETKRKYLQDAVRSRDVFSLLQLYTERTDFSLSLPCPLQEKGETALHLAVLLADRTSLHVA
DFLFHNCNNLDVQTMKGNTALHYCCQHNKTECLKLLLRAKANTHIKNDNGETGLDVARRL
KHSLCEELIHQSQNDQFNMHVHVEYDWRLRQDDLYESDDDLEDKTGPVKKERLGRPFSLY
HSSSSSHAGGGSGGGGLFNVGRRLALARGDNRREVYASPNSQTRSLDSPPPPPPSSPAPP
LPPRVRAPNVPPPPPPMSSPDDWTSHEVKSSKKRTPPPPLIIRHKRTYSEPSPQVPPSPH
STRQGPADYGVPTGPRSFGGPDSPFQKCVSGSPKYPTSTLNSLSELPERGFRADGESGSS
HFLYQTPQPMGSAGRHTPGLSPTSPRSFSLEANGGSSSSSCHSAPHPLPRKNLMKPKLRR
VKAMYDCVADHHDELTFNEGDVLVVLGEDDADWWHGYIEGQPDRMGLFPASFVSMLAE
Download sequence
Identical sequences E7FF53
ENSDARP00000094283 ENSDARP00000094283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]