SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095045 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095045
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Chromo domain-like 9.54e-18
Family Chromo domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095045   Gene: ENSDARG00000092933   Transcript: ENSDART00000104270
Sequence length 342
Comment pep:known chromosome:Zv9:3:18296695:18300272:1 gene:ENSDARG00000092933 transcript:ENSDART00000104270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAVGERVFAAESIIKRRIRRGRMEYLVKWKGWSQKYSTWEPEENILDERLFAAFEER
EREREMYGPKKRGPKPETFLMKAKAKAKSKTYEFGREMSRDIRVSFPVAEPVVTPRAREG
LRTVVPTIFPPSTINRGESVRVRPPDSERDTLTHGTSIQCPLDFTNSPKKRGPKPKMHPA
GGSSSEGIKRKADESLSYRPSKTERSGETSNCDIMHFTQKYKAETNHDGKQMGSRSSDVK
FSHGGSFLKAGLGILGHRQKVGSGGAINQQAKMKHPPKNNLFRSTDQTREQLSLSFVDDT
DQSWLPCLKNMEKIVVTDVTSNSLTVTIKESSTDKGFFKENR
Download sequence
Identical sequences A0JMJ7
ENSDARP00000095045 ENSDARP00000095045 7955.ENSDARP00000095045 NP_991179.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]