SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095048 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095048
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Chromo domain-like 3.4e-19
Family Chromo domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095048   Gene: ENSDARG00000070807   Transcript: ENSDART00000104273
Sequence length 145
Comment pep:known chromosome:Zv9:3:18285032:18293219:1 gene:ENSDARG00000070807 transcript:ENSDART00000104273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPAVGEHVFAVEGIEKKRLRKGRMEYLVKWRGWSPKYNTWEPEENILDPRLLVAFQNR
ERQEQMVGYRKRGPKPKHPLIQLPAFARRSSILGGLQDTSLDEENQPKVDSLQMHRSRPQ
HYQLNSKKHHQYQPSCKEICLCNAR
Download sequence
Identical sequences A1L217
ENSDARP00000095048 ENSDARP00000110239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]