SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097702 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097702
Domain Number 1 Region: 301-421
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-20
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097702   Gene: ENSDARG00000079556   Transcript: ENSDART00000109597
Sequence length 422
Comment pep:known_by_projection chromosome:Zv9:2:53375472:53376740:-1 gene:ENSDARG00000079556 transcript:ENSDART00000109597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMWLLEKIRGSVEGNVLRQGDSADKQSKAPTYSNVLTPDKIPDFFIPPKLVCCPPEEETP
EMKPKNGLHSSTSEQTICCKTPQGSPRSPRLINKLAGDTKNLLKAANRHIIQIESADDLV
VGDAGNLTTNADPQSQTAMSLPYVPKAQTSYGFATLMESPHTRRKESLFHSDPTSPLTSP
NTQRKSQGNHLNPSDCNTSHSNPYRYFSGGESDTCSSAESSPFNSPLLSRSASLLKMFTH
ETQAKVSRAKRSFARHSSLSTDECSSVETSPNIQRRFRCPPSPAFRGRKYGGNMDRFTQH
TVNLHKGGTLRICTDYDIDAARLHIRVLAAEDLYDKQCDAKSINCCVSLYLNPGKLQKQR
STIIKNSRNPVFNEDFYFDSLPVAQVKNLAIKMKVVNKGTSLKRDNLLGEREVPLKELLS
GI
Download sequence
Identical sequences 7955.ENSDARP00000097702 ENSDARP00000097702 ENSDARP00000097702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]