SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097777 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097777
Domain Number 1 Region: 2542-2826
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-120
Family BEACH domain 0.0000000468
Further Details:      
 
Domain Number 2 Region: 2922-3093,3151-3179
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.69e-28
Family WD40-repeat 0.00089
Further Details:      
 
Domain Number 3 Region: 2395-2517
Classification Level Classification E-value
Superfamily PH domain-like 4.86e-22
Family PreBEACH PH-like domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000097777
Domain Number - Region: 1411-1928
Classification Level Classification E-value
Superfamily ARM repeat 0.000547
Family Plakophilin 1 helical region 0.068
Further Details:      
 
Domain Number - Region: 1158-1273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000565
Family Pentraxin (pentaxin) 0.021
Further Details:      
 
Domain Number - Region: 50-119,206-222,249-290,414-516,599-670
Classification Level Classification E-value
Superfamily ARM repeat 0.0111
Family Armadillo repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097777   Gene: ENSDARG00000077009   Transcript: ENSDART00000112653
Sequence length 3182
Comment pep:known chromosome:Zv9:13:31204563:31292318:-1 gene:ENSDARG00000077009 transcript:ENSDART00000112653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPTKQQEPDAEMDRVSKENGELSASGESAESIELKASQINSDKNEDLKEDNDLEEVLRE
QLIQLDTINQQSPEQREQELSRLLLLFIQVSESGSVLDDLDLQSLALQVGEALVSHVQQR
VAEKPAEEARYELEQFFQRSEVKSNQGWLLLKSISFLSNRDTEVGVMIKTGLPAALVKSL
YLFVALPPRKENSDSSPKDVKEDLKCSFQDTLIQGFLQLCRHVCFVEVLLETQELSSVII
SLTLLWDQCSSSWRQQASRVLRSVSAAQAHNTVSALQASNCMKICIQNMHKISEDVPAHV
LAEVAVSVFSFVKDSYAINPALFEEFENNDGYDILQTIILRCEEEVTAEHYLAVQDLLGL
IGSFTLFGKTELKVAICVSNPQPSNFRFDPTLTTGSTVKNLTAFKIIQSSFMRSSNTVIC
SQILRTIQMIWSWEKANFFLLEWTLQSLAQLAECVWQKSPPVHLIFFELLETVIFQLSYI
PHETLKKVQAMVKQGSSGIFNVAALDCFYRLIMNSGLLSEVLSDGGLMEQLLFELKRRAK
IIRKAGVAVNEDEEKADDYQKMLTTNILNVVAALALQSVRNTVFIRDLGMIPYVKIFLDV
EQFRSPALCILEQLAEVNPEEYMSTAIGALCSSTESEIKLKQDLLQSIMKVLENPNSWNA
FRTAGGFTGLLSIVVDMEGSLLETPAGPWASLSRQSLVELLLFTLHTIAFAVHIHPVNAH
FFHTVGVCEKLGEALLHLGCFQKGDPVESDRDSSAYRTFQQFVEVVEKPGPQLPAPLGDC
VKLLGFLEQFATGVSLAADPCTGLQDNNEAGEIQIIDSGQTPEESTNKDEAFNHVRAPSV
SVVSIESGRIYGNFTILHPGAVKLIMTLLPSIYCPSDPCLSEELQLAVAHHVQTLVKSER
NRQIMCEFGLLSTLLTHCKDILIDNSHSLHLPIVRILEKLASQSMDQKCLRHFLCLGDPL
MCCGENQPSVTLEEASCTNQTKDSEENNKKSLKRAMKRSFSLLKTPLDSGMVVPLHRIIS
LVSITSPRNFQPHKVSISPSFVEFDMTDSGYGCLFLPSLATVKGVSADFISTGGLGTDCR
GFPPSAGLSFSCWFMICRFSSACESHPVRLLTVVRHMSRAEQQFSCLTVSISASDGCLVI
STEEEAYQFLDMMEPEVQTPSTLPTSVRFKCAKHLIPGQWHHLCLVMAKGIKKSCLVTVY
LNATAIGTGKIKYIQPFPGQSISMDPSAVIDVCGIIGTPSLWKQHAALVWRVGPTYLFEE
VLSADQVETIYGQGTKYIGNYLALNVQGCKTDGTMSHTKMVSPERISFAINPAVSTITTV
VDIRDTYNEVDCRLIAKEMGITSRDNCTPVFLAHNISQHLSGTSRTIGAALVGCFGVRTF
KSYSASSSFQYIGGPAAILSLVAMASDDSSLYASIKVLLSVLETNPAMEQEMKRTNGYKL
LSFLLKMKVQLISNRIFQLILAIVGTMELGIVPVCIPNVCAFQDVLCDFEVWQKAPDNLD
VCVLNHLTDILKSSSGSQQNADIMHRLNMINKLLILLHDPNVTCRKVSVICTIIRSLLEE
HFNTTDIKRLGLFLVHSLLPPTLNEQNTFSDLDFDDQSQGWSQTPGRSVWIRNQLLSMLS
SLIFSNSSSINQEEVYFALGSDWFLLFLQGHIHTSTVMLVLTLLTHFLSFPNILAKFREG
VSPGTLVETMDIPTSITDNLKCRSWSFECLSCICPGFEVLQKLLVNHIHLPQIYGALAAL
LIGKPNFQVPAGQVDVDMVLQSLIDSCGGKTEDVQLCEDAACVLLELIKVILTKPVTESA
DGWEVHYPGSVMQFFCLVNSLFPQDPLWTSPDFLSSLASAVFPFETPESSTGVQAVKDSS
EGMGEPLLPSHPGRKQVCDFIRILLMDSLINIPAKDGLHPLMQLLEFSPDGVSQEQRQSF
QTELLEFVMDIIHMTGQEEGHSTHVARDDQSKSKQEGKTAVLIENVSFFSKKLVQKVYSG
MFVVEPQNLLVFIAEQIAVALERAQGHREVTVSVLYKSLNRGLLYFLSRPRQTPAEQELI
IQTLHILQEHWDVIMATYNANVHFINCLMHCLVLIRSGSFPEGFGCEVHKKPSRNIWRHL
FPLKSSRVMSQTDIADSAEVESELMTLVESTWSRVMLERRQTLEEAYKIDLSAKSSGKEG
QVSMADVSPLWEEQATKSWQLFIDSQKKKANNSHQKRPGLLSSALQSVQKRFGKDSVGSA
EGFVLDMEAYWQTCETIFDSMLRSHIQMMHSENDRMAIQWLRIEEELLRERGLFGPGPGV
FLKRGWVQDTAEGRNRTRSRIRRKQQRRSKKIPTLTSGLIQKNFVEESKGPVETDADSDP
RILCEASGVVEEEPGLDCEHLTFFPVLNDASLTPDDFSEQCMDTQLILNELKPSEEVKAK
HCVVVVSGHVVTEGALLFGKADLYICEGFTLTSTGDVCCRIHHQTNVRDSYICSMMNKEK
NSVTPSCKRWSYDDIKEANFMRFLLEDNALEIFLKNGTSVFLVFFNNDHVNAYKRLCSVV
SSLKGRGETVLNVRKTSAVEKTVLIKWQRGEISNFEYLMHLNTLAGRTYNDLMQYPIFPW
VIADYESETLDLSSPATFRDLSKPMGAQTEKRKEKFIQRYLEVENNDGDLSAQCHYCTHY
SSAIIVASYLVRMEPFSQTFLQLQGGTFDVPERMFHSIQNEWESASKDNMSDVRELIPEF
FYLPDFLVNSNQFDFGCMQDGTPLNDVVLPPWAKGDPQEFIRVHREALESDYVSSRLHLW
IDLIFGYRQQGMPAVEALNTFHPYFYTDKHDRASMKDPVMKSTMLGYINNFGQMPKQIFT
KPHASRTPNKSTAGKETSVSSQITPFFFKLDKLKPSAQAVKEVSLGPVGQIVCKEKDVLV
VEKNKLLIPPQLNTYFCWGSYDQTCSFGSYTGEKSFGVCESLSDWGEPVCAACPNNSTII
TAGTSTVVCVWDVFISKDKLKHMRLKQTLYGHTDTVTCLVASEAHSMIISGSLDQTCILW
DLEDLSYITQLPEHSSAVSALAINDLTGEIVSCAGTHLYLWTMKGQLLASINTYYEPEGN
ILCCCFTQKHEWDPRNVIITGSADGVVRIWKTEYTRVQLPGHEECSVSQGHVLSSAPEEA
DSGSWRWERHLVLCRELNRNQAISRRRCKNNPAITALGISRTHGTLLVGDAWGRVFGWSC
ES
Download sequence
Identical sequences ENSDARP00000097777 XP_005157006.1.45394 ENSDARP00000097777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]