SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097870 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097870
Domain Number 1 Region: 80-394
Classification Level Classification E-value
Superfamily RNI-like 5.89e-45
Family 28-residue LRR 0.065
Further Details:      
 
Domain Number 2 Region: 5-106
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000759
Family F-box domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097870   Gene: ENSDARG00000034497   Transcript: ENSDART00000109520
Sequence length 411
Comment pep:known chromosome:Zv9:25:21734489:21736606:-1 gene:ENSDARG00000034497 transcript:ENSDART00000109520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIHISSLFPEILAMIFNYLDVKGKGRVAQVCTAWRDASYHKSVWRGVEAKLHLRRANPS
LFPSLQTRGIKKVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLR
ILNLSLCKQITDSSLGRIAQYLKNLELLDLGGCSNITNTGLLLIAWGLHNLKSLNLRSCR
HVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKGLNKLKVLNLSFCGG
ISDAGMIHLSHMTQLWTLNLRSCDNISDTGIMHLSMGALRLYGLDVSFCDKVGDQSLAYI
AQGLYQLKSLSLCSCHISDDGINRMVRQMHELKTLNIGQCVRITDKGLELIADHLTQLTG
IDLYGCTKITKRGLERITQLPCLKVLNLGLWQMTEVKGLGDASEILPLYAS
Download sequence
Identical sequences Q6TGX5
ENSDARP00000050028 ENSDARP00000097870 NP_958890.1.45394 7955.ENSDARP00000050028 7955.ENSDARP00000097870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]