SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098436 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098436
Domain Number 1 Region: 354-488
Classification Level Classification E-value
Superfamily C-type lectin-like 1.45e-40
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 2 Region: 924-1074
Classification Level Classification E-value
Superfamily C-type lectin-like 3.48e-40
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 3 Region: 783-917
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-35
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 4 Region: 497-626
Classification Level Classification E-value
Superfamily C-type lectin-like 8.77e-35
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 1215-1347
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-34
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 6 Region: 645-784
Classification Level Classification E-value
Superfamily C-type lectin-like 3.58e-32
Family C-type lectin domain 0.0000625
Further Details:      
 
Domain Number 7 Region: 1081-1214
Classification Level Classification E-value
Superfamily C-type lectin-like 9.95e-32
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 229-347
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-30
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 25-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-29
Family Cysteine rich domain 0.00000793
Further Details:      
 
Domain Number 10 Region: 158-215
Classification Level Classification E-value
Superfamily Kringle-like 1.17e-20
Family Fibronectin type II module 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098436   Gene: ENSDARG00000073928   Transcript: ENSDART00000112544
Sequence length 1440
Comment pep:known chromosome:Zv9:7:65408686:65468212:-1 gene:ENSDARG00000073928 transcript:ENSDART00000112544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTFDNPLFVLLFLKIALQLSSQTDTSYFLIYNEDHNRCVNAVSATVLQTAPCDISSEGQ
RFRWVSSSQIISLSFKLCLGAQNIKDWVKIILVPCNALSPLQTWECKNETLFGLKGQPLH
MNYGNRNEQNMMLYKGSGIWSRWQVYGTKDDLCSHGNQEIYTIGGNSFGKPCQFPFKFAD
KLYAECTTEGRSDGQLWCSTDTDYDTDKKWGFCPTKTSSGWDSDPVTGVLYQRNVQSILT
WHQARTSCQQQEADLLSITELHEQSYISGLTNTFGSALWIGLNSLDFESGWQWSNGNPFR
YLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNF
CPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDEL
WIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVLIKGKDGKWADHACEMER
GYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVD
VASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPEKHRGCV
AMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQI
YSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYGMGETAWIGFNLLNINSGFVW
TDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSP
PTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVW
KQISRGSENQYYIGMIVNLDKSFNWVDGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFW
NDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARN
LCISHGGNLVSILTHEEQAFLTTLMLDSVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAK
GVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIR
PVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKL
KEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPKNNLACVYIDTDGRWKTATCNNTYY
SLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGS
LVSIEDPKESHFIQRNVELMQDGVRSFWIGMHRSYMGDWMWIDNAVVDYTNWRTQVTNNA
GHCVEIQSSSGLWNAVNCNSYKPYICKTEKVVPPTKKPLVPLAVVDAGPHSSAGIVVGVV
LVIIAVAGLATFLFLKRIPRPAIGECTFDNRLYINSDLTQSPTTIDTKGLVANIEQNEHA
Download sequence
Identical sequences A0A0R4INM0
ENSDARP00000098436 XP_002663014.2.45394 ENSDARP00000098436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]