SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098469 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098469
Domain Number 1 Region: 163-307
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-42
Family Third domain of FERM 0.00048
Further Details:      
 
Domain Number 2 Region: 62-161
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-26
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-17
Family First domain of FERM 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098469   Gene: ENSDARG00000070495   Transcript: ENSDART00000109141
Sequence length 678
Comment pep:known_by_projection chromosome:Zv9:1:9506238:9519118:-1 gene:ENSDARG00000070495 transcript:ENSDART00000109141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDFFNKVCGHLKLLEKEYFGLEFRHHNGSFVWLELLKPVAKQIKNTSDVAFHFIVKFF
PPDPGQLQKGLTRYLFALQIKQDLSNGSLTCNDNSAALLVSHILQAEIGDYDDELDAHHL
ENKQYVPNQEYLDHKIIRFHKKNRGHTPGESDVHLLEVARKMDMYGIRPHPAHDGEGMRI
NLAVTHMGVLVFQGNTKINTFSWAKIRKLSFKRKHFLIKLHTETGPSRRDTVEFSMASRD
VCKAFWKMCVEYHAFFRLTEEPKSHQKSILSSKGSSFRYSGRTQKQLLECVGSGDKKHLP
FERSYCKSEHDTRQCRSSPDILTDVSKQLYEHLPPNPTVTRQHSDQTGVTKRSLSAMEVM
FTNELETSRPLSRNPAFSSNSASPKLCSLSTSGAEHRSRGPQRQKAKRRLSPSAQHLVLL
YPNAPHLQFHPVLPTFPLATHPYLLQDHTSSSLDRLPQTHQNHVPLQYLPRQISHSSRLT
SCLSPQLQKQQERLRPVGLGLGESRLHPRGGLGLRAGLNRKLDLSRVEAGHYSDDSTFQT
GLPRRTSSQPDFQFQRPTLASNAAAYASEYRPLGYYPHLSRHQVPARPTYLPLSPIPLPE
RPTSLCVLGTSSYSDSDSDTFYPYFPTLGKVVRSGPLARMRISSGSLQLDEEDGEDEEED
CLNDQESTALTTVKVMKL
Download sequence
Identical sequences ENSDARP00000098469 ENSDARP00000098469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]