SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099237 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099237
Domain Number 1 Region: 27-159
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 9.68e-49
Family N-terminal domain of cbl (N-cbl) 0.0000184
Further Details:      
 
Domain Number 2 Region: 246-332
Classification Level Classification E-value
Superfamily SH2 domain 1.37e-44
Family SH2 domain 0.00000934
Further Details:      
 
Domain Number 3 Region: 340-416
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-40
Family RING finger domain, C3HC4 0.0000749
Further Details:      
 
Domain Number 4 Region: 160-245
Classification Level Classification E-value
Superfamily EF-hand 3.13e-39
Family EF-hand modules in multidomain proteins 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099237   Gene: ENSDARG00000078217   Transcript: ENSDART00000110619
Sequence length 502
Comment pep:known_by_projection chromosome:Zv9:16:28000382:28040100:1 gene:ENSDARG00000078217 transcript:ENSDART00000110619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAMARRPGTAGRSQISDTSETPSQPPTSADRKLLEKVLKRLDKLHKLSVDPRLALKNSP
PYLPELLSETAIHLTEVWAPYRGSAMAVPRWDEGDYMRIHIRHLLDKTDRAVLLFKEGKE
KMFEETSNYRRNLTKLSLLFSHMLNELRTIFPGGRFQGDTYRVTKTEAKEFWRKTFGHKC
IVQWNVFKQQLKRVHYFEEGMEAMALKSTVDLTCNDHISIFEFDIFTRLFQPWSTLIRNW
NHLAVTHPGYMAFLTYDQVKARLEHYRHRPGSYIFRLSCTQMGQWAIGHVTSDGSIVQTI
PQNTPLYQALIQGFREGCYLYPDGRDVNPDLSSLCSPVHKGRVKVTEEQYELYCEIGSTF
QLCKICTERDKDTRIQPCGHLLCQPCLTGWQKSDGHTCPYCRCDIRGTESILIEPYLPIR
DKRAEEEEEDDEDDDDDEEEDHEDIELVMKKLACMKKISQEEYQIPRSSLSPPPLPPKRN
SSSPCPSPKPQTHRSFSLGAQK
Download sequence
Identical sequences F6PCP5
ENSDARP00000099237 NP_001121724.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]