SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100164 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100164
Domain Number 1 Region: 479-847
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-137
Family Hect, E3 ligase catalytic domain 0.00000000000782
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-23
Family PLC-like (P variant) 0.00000555
Further Details:      
 
Domain Number 3 Region: 384-422
Classification Level Classification E-value
Superfamily WW domain 0.000000000000821
Family WW domain 0.00051
Further Details:      
 
Domain Number 4 Region: 308-341
Classification Level Classification E-value
Superfamily WW domain 0.00000000000131
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 275-308
Classification Level Classification E-value
Superfamily WW domain 0.00000000000138
Family WW domain 0.0011
Further Details:      
 
Domain Number 6 Region: 425-460
Classification Level Classification E-value
Superfamily WW domain 0.00000000000871
Family WW domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100164   Gene: ENSDARG00000074903   Transcript: ENSDART00000111497
Sequence length 853
Comment pep:known chromosome:Zv9:6:57442386:57482006:-1 gene:ENSDARG00000074903 transcript:ENSDART00000111497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAQLQITVLSAKLRENKKNWFGPSPYVEVFVDGQSKKTEKCTNTHSPKWKQSLTVIVTP
FSKLIFRVWSHQTLKADILLGVASLEVSETLKANNMKICEVVQTLQLSSDRGRSEQVGDL
SLCLDGLQVDAETFASEEQKHITDAVVNGESRLNGDAIRSRDSSPSSDITDDAPLPNGHA
VGSSASASPSTGALRAPRPLRPQRPPPASPHKHTSSTASSTGSTPTHGSSAPSPEMSPRV
CVNGETESQGSSSGSGSNQAPRASPTPPRAPAITNGPLPPGWEQRADQNGRVYYVDHIEK
RTTWERPEPLPPGWERRLDPMGRVYYVDHINRTTTWQRPTLESVRNYEEWQNQRSQLQGA
MQRFNQRFIYGLQEQLAPTANKEFDPLGPLPSGWEKRTDSNRRMYFVHHPTRSTQWEDPR
TQGLLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSSLENGPQITYVRDFKA
KVHYFRFWCQQLSMPQHIKIHVSRKTLFEDSFQQIMGCHPQDLRRRLWIIFPGEEGLDYG
GVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASSINPDHLKYFKFIGRFIAMALF
HGKFIDTGFSLPFYKRILNKPLALKDLESIDPEFYNSLIWIKDNNIEECGLEMFFSVDKE
ILGEVTTHELKPDGGNIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFLEGFNDVLPQQYL
QYFDAKELEVMLCGMQEIDLGDWQRNSIYRHYARSSKQIVWFWQFVKEMDNEKRMRLLQF
VTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKL
LFAIEETEGFGQE
Download sequence
Identical sequences ENSDARP00000100164 ENSDARP00000100164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]