SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100284 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100284
Domain Number 1 Region: 1379-1558
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000196
Family RUN domain 0.013
Further Details:      
 
Domain Number 2 Region: 1822-1874
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000197
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100284   Gene: ENSDARG00000078125   Transcript: ENSDART00000114322
Sequence length 1877
Comment pep:known chromosome:Zv9:16:15791468:15824231:1 gene:ENSDARG00000078125 transcript:ENSDART00000114322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPSSRPSVPPRTRRFDNRRTEPKPSQGAKREDKNMNTGSSSPRRGTRGPPESSRLKGPG
QGARAPVVQSKLTRPVRNGAHAIPAVSKPKSGRAVSNLAPAVDPNCNEPSLPCLCCDGHS
PQDSNSLFNHNHNNNNTVNIRQQMKIPPPSPPNELPFPKQETEDDKCEPEVKQPDDLPFP
VEEKEEENGNVDKKEGDDLKNDDCSVNVIGNVDVNGNGNCDGDDDEDDDEDDDDTLVPSC
CNCPESMLDFSLTSSTSSSSTSISSCSDLECDCPDTFSLSSQDQEGPECYPSSCSPLSSC
PSFQSNAIPLDLNLSARSPCSSDEGYPSAPCSPSDYTEGKFSEEEKCIKVDLLHFLDSIE
ELGKMDLFYRIVRLAHWQLDGELILRDRLDHQQKLQRVNKEVKLAYFVKLQEEGFNFGDE
DITGVLDEMGNIDIPWKLYKSNKSSDSQEFSDAGVDLTAPSDLDETASSDSLAPSPLEPP
PRPPKPPTRHVSVQQGSHTYENISGHTFSAPSTNNATSFSTSVPVPSMASTSPALKPPAL
PPPPSQPVPYFSLNSDRPAHSSPTPPIPPPRRRHKARLEAQRLAELEKEKTPLSLPPPTS
RPPPLPPPPAMSSPPAIPPPPSIPPPPSFHALDVEIRKLLALAGLTQAELLKLSPELGVC
VDVVVDNEQHPMSDVSQIGEISANRAHKEDSMDKRLHCRLREETRFGKDIQKVETLSENE
ISKDGQKEAYRTTSFTEMARRRKRNSGNCNQNCNCGFGSPNLYYSTDLSNTSIPNVSFGS
FDYTSVISDTPPPPPPRPLPPCPPVISNPPELPHLKPCTLPANASRPDRFDWLIAFTPDI
EPPPTDMRKPSNDGMLPKGSISGPKVTTFKELRNRSKQSSPPAPVQPEPDPTVITPDPDF
LYNLKWRREKTDGDGWEYTSQAQASFLQPPPTPASLSLFREMCRLNIQDECRADPKVSQQ
MGSSVSEGSLRTICGDKAAHTKKIQNEDDLEVRGMADGAWTLESRTTVSSPPLSLSLTSP
YYLHSASLSQASQFYHTDTTSDHAMSYYEGSVNISNPLCINSTFDCSKHDYTDSLYSAGP
ENNTFLFCKQENGLSGGMDSQYHHCYHADSFLDSLYVCGHEPGSAKNSFCPVYNNEVDSI
RNDGSLYSDSRYLGNPLKLFTDPEPPTDINTLTEGDITPYKNIDMQTYITMRNLKNKSNA
KKSTYKDADSLFELNSGNINDSKPSNNPFFDSGEPTKQDKLVSFPAYYLYNPKNCPLHKG
APPRLSPVGAISPPHRSGPPVPGTDVARLCSPLFPRSHTIPALAAPLYYPYLYTPPVEAP
VREPPVPILHSLQSPPPLTFTVRSFSFAGSEQKNGAWMGEDVRSSMSAEGLSSVCLLEKK
TLVNSVSVAVEAILAQFSSSRTVVQKSLSGDSSVNPSLGRLVLQCLCPALRSLLCDGLKP
HQSDLIAGRRPNSPWGLVQASTKPGPSTQALHSLQTKVAGLHQLRQSRHRFNAFLFGLLN
IKLLDYWLSHLQSCSDVLETFYRPTSFMRLSLTSCQSLFEELLLLLQPLSLLTFNLDLLF
QHHHLDPSSPTLTPASHTSDICSPPNEDFSFHLSPKGLFHGGVHRTGSILEQDHSLSLDT
NPNSFFSSHVLDVSAYRNPISLSSGINKEEADPPLSWFNGNEISAPLNAGSLSQQAGQAL
QQGWGAVMRLGERLGQNFGLATTTENANGPYSPDNSKTGYSATPRSPVENRQQPREDLSL
WDSGAAIPWGLGRLFGASKSPNNPPTTRRPSQWLSPGVSVLSRIVNLSQGSPPEKRELQR
SNDKEQDENENINEPRDQPKPLRVVRTLCDHTGTGAELSFRKGEELVLLGGVDHDWIRCR
QGHREGLVPIGYASLIM
Download sequence
Identical sequences ENSDARP00000100284 ENSDARP00000100284 XP_005157969.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]