SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100767 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100767
Domain Number 1 Region: 200-281
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.16e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 
Domain Number 2 Region: 7-40
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000212
Family Ypt/Rab-GAP domain of gyp1p 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100767   Gene: ENSDARG00000078274   Transcript: ENSDART00000112232
Sequence length 311
Comment pep:known_by_projection chromosome:Zv9:21:164366:166813:-1 gene:ENSDARG00000078274 transcript:ENSDART00000112232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLNPNPDSRWNTYFKDNEVLLQIDKDVRRLYPDMAFFQRPTDFPCQLILDPQNEYETLRR
RVEQTTLKAQTVNRNRSGVTNVSALVKYTHTHTHTHTHTHTHTHTHTHTHTHTTHTHHTH
TPHTHTHTTHTHSPHTHTHHTHTHTHTHHTHTHTHTHTHTLTHTHTLTHSHSLADRECVL
TVGMKSGRSSVDAADSEEFSSLQEQNIKPQYFTFRWLTLLLSQEFLLPDVIRIWDSLFSH
QDRFEFLIPVCCAMLTLIRDQLLAGDFTTNMRLLQDYPISDVHHSRSPERSSMNRSQIRG
WSDDGLLYLYQ
Download sequence
Identical sequences F1RCX9
ENSDARP00000100767 ENSDARP00000100767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]