SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101376 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101376
Domain Number 1 Region: 50-108
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 860-918
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 3 Region: 752-805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 4 Region: 628-696
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 800-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000549
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 698-748
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 575-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000127
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101376   Gene: ENSDARG00000075487   Transcript: ENSDART00000114199
Sequence length 963
Comment pep:novel chromosome:Zv9:2:20324812:20368733:-1 gene:ENSDARG00000075487 transcript:ENSDART00000114199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCLWTARVGHTLLPYFLIHVWIINTAAGVNVKDSSEGREDLQRHPDEVAQWWGEWSSWS
TCSRTCGGGVRSQERHCLQQRLTSTQNINSSFCIGPSKQYQLCTNQPCPNSRISFKQHQC
SQFNAKAFSRKHYEWVPLYPDDYINISNKPCDLQCTTTTGERQLLVPAHDGTFCRDGIYQ
GVCIEGQCQVVGCDGKLYSSKTIDKCGVCGGNGASCYRVSGTYRKGITQLGYVFITNIPV
GATDIQIIERRKTENILALSDEAGHFFFNGNSVIDNPQNFHVAGTVFKYRRPANLFSDGF
EYIMAQGPTQQALNVMYYNLNGKMPHITYEYTVPRAPAFPMTSTPEQPQISNLMSKTSRD
SSVAEPKGNTSSTEHNEIGARKQHEKKSNQSSSLVPQDNVDVHEELLWGLQASVNFSELP
ALVLFRPASEVLQNELDDEIHHLEAQENFGPDSNLIDGDSSSSSDSNTSIPLLKSLLYDG
ASWSSRQPCKDSSALSGCSILKLNSSAPLDNSLTLEIYPGSLDLHSPDGEPRTNDSTNHQ
SNILQLHQMEPVQAPHSESNEFEVESLDHDVSMSDMYRWKVSAYAPCSSTCTTGISTSYA
LCVKYDGTEVDESYCDALTRPEPTHEFCTGKECLPRWETSRWSECSRTCGEGFQFRTVRC
WKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEISDWSECSARCGGRGVRSR
DVRCSMEARLCNESTKPVSQRECEGPPCDRRWTVSDWGPCSGPCGEGRMKRYVVCKNSNG
KVISDGQCDPELKPLAVHPCGDKNCPAHWVEQEWEQCNSTCGRGVKTRQVVCAGLEAGVF
KEFPERMCDRALRPADTAACFERPCSKWFTTSWSQCSKTCGIGVRVREVKCYQGEELGHS
CDTTLRPEARQSCEVQPCTTEPPADDACQDKPTANCALVLRVKLCTHWYYRKACCLSCRN
KSQ
Download sequence
Identical sequences E7FE04
XP_696251.5.45394 ENSDARP00000101376 ENSDARP00000101376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]