SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101738 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101738
Domain Number 1 Region: 374-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family SPRY domain 0.002
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-20
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000427
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101738   Gene: ENSDARG00000073735   Transcript: ENSDART00000109246
Sequence length 505
Comment pep:novel chromosome:Zv9:2:60000855:60004784:-1 gene:ENSDARG00000073735 transcript:ENSDART00000109246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSLSLAHHFSCAVCLDLLKDPVSIPCGHSYCMSCITDCWNQEDQKRVYSCPQCRQTF
SPRPALAKNTMLAEVLEKLQKSKLQAAGPAQSPAASGDVECDVCTGAKNRAVKSCLVCLN
SYCHTHFQRHQEIHQGNRHKVTEATHKLQEMICPQHKKLLEIFCRTDHCCICYLCLLDQH
KHHDTVSAAAERTELQSRLRETQSRFQQRLQERQKELEELREAVESHKRSAQAAVDHTER
IFTQLICWIERSRSELTQMIRDGEKTAVSGAEERLERLEQEINDLRRRNAELEQLSHTED
HIHFLQSLQSLSVPPGSTDSSSFISSSQLAFDQLAESVSRLRDKLQQFCTEEMKTISSRV
SSISRIPAPEPQTREQFLQYSQQFTLDPNTAYNRLVLSEGNTAVENKRSVQPYPDHPDRF
DGWRQVLCRESVCGRSYWELEWSGEDVEISVSYKSISRKGLGNECVFGFNDQSWSLSCSA
HSFIFYHNNIKTDLRKPSVSCSRIG
Download sequence
Identical sequences B0S649
ENSDARP00000101738 7955.ENSDARP00000102534 ENSDARP00000101738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]