SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102474 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102474
Domain Number 1 Region: 1645-1786
Classification Level Classification E-value
Superfamily SET domain 5.49e-46
Family Histone lysine methyltransferases 0.0046
Further Details:      
 
Domain Number 2 Region: 80-161
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000166
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102474   Gene: ENSDARG00000077244   Transcript: ENSDART00000114080
Sequence length 1789
Comment pep:known chromosome:Zv9:8:35881255:35898143:-1 gene:ENSDARG00000077244 transcript:ENSDART00000114080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NWSCYKLIIDPGLTSGSQKVYRYDGQHFSEPHPECFPVDVVRDPRITRFWAKFKNADLPV
PKLKVDEYYVGAPKELTFARLNDNIRDGFLSEMCKCFGEIQDLKVFYNPKNKKHLGLAKV
VFESVKAANNAVKNLHKTSVMGNNIHVELDPKGLKRHRYFQMIVNGLYTPFTLPVEEEAW
GPQSPSSITDSLIECESLKKLTYTLSSSSSICNGSPSLDCSTPLSMDTAYSSMHQDTPSS
FWQTPQYQDTPRTPSVTHSRPGTPSQCERTPNESTLINTGPIVPFIQQSTLNISHFQPGQ
PAINKPSTIQHAVQNFWMLSGTPSHNGIFSNRQRTPGGNSHPSNHVRGGHRVRPLESKYQ
NAYNRRPQHRHYIHRPVYRRGHYHRALATNQVTLNRFQETPTTPLYSEKNVYASENTLTQ
TASPVPSKTTYDVNQNHYPSQAQSSHSYVPKLCSSPETTEDISEPTVECPSPEFPAPESK
PDSLDTRIQMLLSAGSPVLPLLNQDSSDSESTEENDHHQRSSRAPSPTQSLTTGVSLKDT
SSYPRENLSGMEDVNPTALYDVAEDKHELPSPKKPLSKMPSSTIVKFQLTLNSTEHSNSV
ASSLLLQVNPNEDQDTSDQPSSIPVICTNRSTSTPPMSEIPPPPMPSVHYPFLPGYSLPT
SSCSLYPPSIIKQVCRRSNWPTSLAPLPIPTRITQGQTSLSPSFLPQSFSFMTHRPPYPS
PGCSSTMLRYRPPWPPPPPIPRFDPSVPPPGYVPIKESPHKATVDGVLAVVASELRAIVK
KDIHRRMIEIMAFKAFDQWWDDKEQAAKVSAPAVKSVGNKDIKLRVMEQSLRLGTAGGEG
CILDSGKIKSLHGAIKLPSFKLKRKGPSGQGSTDVKRICPSPGPEHSEDEESEQQTAPDC
VDETTVLNASEDTMVKRRHSRPLALDSEEEDDEENSEKAEDPKPEQVHACDRVDIKKVTK
DQTSDPCVIVDDEDTDTGIHHFCSLSVIDSPVSSRPVFVSSDDRSDESSSVSSAEDDQSD
GQSSPETPREDRRVVETIWISSDEDDDENQETLHTPVFLPSPHSEEDLQPPVTPSAPDSI
ESDVDNDFFVEATEWTRCTGFITENPVIVYSYLDPAQMEDPEEELSVRVYMQGLKLPEPL
RYTLQDPVKHCLTNKLKLPDPVIFFSDQESELPSPPSPTYRGLSDDLETQYTTDSEDQRV
IMEALEDPVHLRPITPTGFLSDSDPDIEMGRKFSPPAIEEVDLPHTPGRCLELEDDENNI
LPPGPPTPLPPPPSPTGIKELPSSPLYYGIPLLSSYPGYEEIPKTPGRVNDPGFVFHSER
ITPPQEPSRTLESPCNPFLSSFADSGIPRTPGRDMSLSPPVLNHRERHVQHRELLKYGQR
HRNSDFAHKNNSHTPRSDTARLKRRRERLKKRQRMIELQRSRRCTDLNTHSSLQVSSATT
KPTNQSLEPLDRVSNIRTEESNNSQQIETQRLSESSYVRRDSSLTPHLIFTPRSKRREKL
VLHAVWTKGVNEEEIRHLKASYERLVVEDNEYDWLRRTRWIPHPHSGAPTSTSDDRPRRW
LDGVRNHLTGCARSEGYYFISKREKLQYLCNERTVSEEFTADSQGKSVSAQVSHSSRSGS
ELRAEQRRLLSSFSCDSDLLKFNQLKFRKKRLRFGKSRIHDWGLFAEEPIAADEMIIEYV
GQSIRQVIADMRERRYETEGIGSSYLFRVDHDTIIDATKCGNLARFINHSCNPNCYAKVI
TVEAQKKIVIYSRQPITVNEEITYDYKFPIEDEKIPCLCAAENCRGTLN
Download sequence
Identical sequences ENSDARP00000102474 ENSDARP00000102474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]