SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103259 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103259
Domain Number 1 Region: 477-554
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 4.18e-29
Family HIV integrase-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.9e-29
Family PWWP domain 0.0000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103259   Gene: ENSDARG00000019530   Transcript: ENSDART00000113824
Sequence length 662
Comment pep:known chromosome:Zv9:22:22597221:22622561:-1 gene:ENSDARG00000019530 transcript:ENSDART00000113824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHNFRPGDLVFAKMKGYPHWPARIEDVADGAVKPPPNKIPIFFFGTHETAFLAPKDLFA
YEKNQERFGKPNKRKGFNEGLWEIQNNPHASYNTPAAASSSDSEDNQPAAASDAEEEEEA
VVPRKAETGSDDSDSGSEDQKKPAVKRKAPALKRPPVKKARASSSDRDGEESGSPSEPEP
SPSSDSDSGKNSDQDFTPQKESGGRGGKKPAGRGRRKKASSGSDSDSGSQSDQKAARSDS
EDEKPRPAASGSESQSGSKSDSDSEPPPPPPPTRKAPQGRKKAEKPPPKPRARKPKPAPE
RAPSSSSDSDSDSDTDRVSEWKKRDEERRKELEERRKREEAEELRRLREREKEEEEKRKK
DKETKVRRGSSSSGSSSSDDEVDDHPLKKSKKPPPPPIPAPSDSDSPPPSELKKKKESQK
GRQKKEKEVKEKKERPVKEKKPQRSEEKHKAKPKAEKPKRKPVRPPEKKVEKKKEPSPEE
KLQKLHTDIKFALKVDNPDIEKCLQALDELSSVQVTTHILQKNADVIATLKKIRRYKASN
AVMEKATAVYNKLKLQFIGKIETGKPKPNEKNQEEQDAQNTDDSKPVNGESEGERKDVSE
SESNSKPTDQDNPDENKSPNGIRPDPDEPADQLNDSTEADPTADTDVKEDSREQDEQMSS
ES
Download sequence
Identical sequences G8JL25
ENSDARP00000103259 ENSDARP00000103259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]