SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103303 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103303
Domain Number 1 Region: 525-709
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.77e-24
Family Pectin methylesterase 0.072
Further Details:      
 
Domain Number 2 Region: 668-828
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.46e-24
Family Pectate lyase-like 0.058
Further Details:      
 
Domain Number 3 Region: 269-325,367-492
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.14e-22
Family Pectin methylesterase 0.053
Further Details:      
 
Domain Number 4 Region: 158-241
Classification Level Classification E-value
Superfamily F-box domain 1.83e-20
Family F-box domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103303   Gene: ENSDARG00000061631   Transcript: ENSDART00000112918
Sequence length 929
Comment pep:known chromosome:Zv9:12:26349662:26411104:-1 gene:ENSDARG00000061631 transcript:ENSDART00000112918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSVRASSRRPRRVSRPRPVQPERNNAEREPPSANQTELIPSSFAGGGGSAMINQKPLFP
RLGRRSLQSERWNLGLVDEDIPADMVAEESGPGAQNSPYQLRRKSLLPKRTVCPTKNSME
GASTSATENFGHRAKRARVSGKSQDLPAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCQAA
CVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEQPNPWKESFQQLY
KGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGIYTDEWI
YIESPITMIGAASGKVADKVVIENTRDSTFVFMEGSEDAYVGYMTIRFNPDDKSAQHHNA
HHCLEITVNCSPNIDHCVIRSTCTVGSAVCVSGQGAGPTIKHCNISDCENVGLYITDHAQ
GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIA
GFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRG
NAIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVH
EKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLEDNDIYN
HMYSGVQIRQRTGSNPKIRRNKIWGGQNGGILVYNSGLGFIEDNEIFDNAMAGVWIKTDS
NPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFDGFA
AGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYK
ISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNP
CTLAGEPTHDTDTLYDSAPPIESNTLQHN
Download sequence
Identical sequences ENSDARP00000103303 ENSDARP00000103303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]