SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103733 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103733
Domain Number 1 Region: 76-124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 37-80
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000968
Family Somatomedin B domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103733   Gene: ENSDARG00000079897   Transcript: ENSDART00000114769
Sequence length 269
Comment pep:known_by_projection chromosome:Zv9:6:46418400:46431061:1 gene:ENSDARG00000079897 transcript:ENSDART00000114769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACSSWMVFCFLALLVTLVSQSEGGCQDTGMCCIGQNQSCISEDWRKDRSFGECYCDQACK
TTLDCCHDYDLACPAVSCVVSEWSLWSGCLEPCKPTLRSRRRQVIQEARNGGEPCPSLQQ
TAGCAEYHDQHGPCLQSLVPALITTGGYGNARKKREVLDNITGTTTTRASYCVEFELTSL
TAGCQRSFSSHTRWMRYLKEGHQVCVECQPPALTPGQRYCSGDGENMGYDRSVSLQWQAV
GNSQCRGVWRRVRRRESCSCPTVHSFLFI
Download sequence
Identical sequences ENSDARP00000103733 ENSDARP00000103733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]