SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104975 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104975
Domain Number 1 Region: 85-259,328-632
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.87e-53
Family Tandem AAA-ATPase domain 0.025
Further Details:      
 
Domain Number 2 Region: 895-974
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.58e-16
Family Tudor domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000104975
Domain Number - Region: 727-777
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000149
Family Canonical RBD 0.046
Further Details:      
 
Domain Number - Region: 937-1051
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0144
Family Staphylococcal nuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104975   Gene: ENSDARG00000013453   Transcript: ENSDART00000124958
Sequence length 1344
Comment pep:known chromosome:Zv9:13:31625767:31646845:1 gene:ENSDARG00000013453 transcript:ENSDART00000124958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQAITSAQIAHWFTVGAQFANIRITNEAKKAEAEDNATEVRSDKAFSELSSPEKEKSDD
GNQRRKRAQLPTGPGTSPPSLASYEYPILPITKNRQELVSLIENNSVVIIRGATGSGKTT
QLPQFILDHYAERNIPCNLVVTQPRKIGATSIARWVARERKCTLGSLVGYQVGLEKMATE
HTKLIYVTTGVLLQKLVSSKTLTEYSHIFIDEVHERSEELDFLLLVVRKLLRSNSRYVKV
ILMSATINCIEFAEYFGSPIRNQMNPAYVFEVEGAPYAVEEYYLDELKTMLPVGVNLDLT
LPQDPYITEEMYNVAVSLIQSFDEMEAKDHRSRRSEQTGSTTHPERGSVLVFLPGLAEIQ
YMKEALSKLVRKRLQVYPLHSTVTLEEQNGVFLVPVPGYRKIILSTNIAESSVTVPDVKY
VIDFCLVRQLACDKETNYRCLRITWASKTSCNQRRGRAGRVSKGFCYRLVTRHFWENEIP
NFSIPEMLRSPLASTLLKVKLLDMGDPRSVLSTALTPPILGDIERTVLQLKQIGALSVQS
NSQRQFDGDLTFLGRVLAQLPVDLQLGKLIVLGHVFGCLEECLIIAASLSLKSFFAMPSL
QQLAGYRSKLSFAQNVPSDFIAYVNAFKAWYTSRAKGELRHPKDELEWGKENCIQIKRIR
EVAELFEDLKKRVSRFNMHISSSSNPTDYTSLHKQRFILQVVIAGALFPNYFSQGEIDEQ
LASKELSGNDPKTTILIRNLPPFAFLCYKQLQSLFRQCGQVKSIAFDGSRAYVEFHRSCV
RESGVLHEVLLALLRSRHTPALHLQVHHADEVEFHAKGKPIAHLRYTRVNVDVQSHTVSP
VGVLSSSVNPEKLPTSRDFVINITEVIDVGHFWGFQTDENSVEKQCQLTAALNMRDLRPL
SVSLYPNLLCVAPFKDGQQMAKYYRAKVLHILGSNVEVFFVDFGNTTVVPSSSLRELPSD
LMTPAFQAQEFCIARMAPSAQSLILGDRWSSRARNRFKTLTSGRSAIVSLFSILHGVMRV
DLHISTETGDVSVADLLVQEGHACHTPESFESQQSHEVLISLYEDMASGRFTPSFASGSL
NSRMEEDKQLINQLLLHFCSSGSSAPKCKAVVHGPSSPHKVNFHSMSKVSNFRSVNIERD
SINCVMVNENPQDWHERMLVAASVSLSASGSRILLKETSLMPHIHGLPSLVTMLFTPVME
LRTNEDRTCFTGALCGLGWNSVSQEAVLPEHDIEIAFDVKFEIEDITEINALRGTVNRLV
CDGPNGLLNLSQEKISSLQEEARERLIRLFIKTPSRPECTPVYHDKFKKWNLVDRSQQME
IQEKDDGKSKGVLFQLHPITLLNM
Download sequence
Identical sequences ENSDARP00000104975 ENSDARP00000104975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]