SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105523 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105523
Domain Number 1 Region: 66-291
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-66
Family Nuclear receptor ligand-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105523   Gene: ENSDARG00000056541   Transcript: ENSDART00000128468
Sequence length 292
Comment pep:novel chromosome:Zv9:11:30559749:30562664:-1 gene:ENSDARG00000056541 transcript:ENSDART00000128468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQTSAVHGHLQACSSAQFQQRNISSSARMAYFDSGCHCSSERRQNSILYSILKNDSQSAQ
LGNQPRAPRLAVSMRACACGSKRKVSLRSPQTTCKAASAVLVKTLKFVKNVPCFRELPAD
DQHTLVRSGWAPLLVLGMAQDRIDFETSETQEPSMLQRILTSGQDKQDNQSHNGGVALTD
VQGIKMFLRKCWGLDISTKEYAYLKGAILFNPDVAGLQCQHYIQALQSEANQALNEYVKM
IHRGDSARFAKLFLALSMLRSINANVVAGLFFKPVIGAVNMEELLLEMFYGK
Download sequence
Identical sequences ENSDARP00000105523 ENSDARP00000105523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]