SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105671 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105671
Domain Number 1 Region: 495-806
Classification Level Classification E-value
Superfamily L domain-like 6.72e-42
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 886-1042
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.93e-35
Family Toll/Interleukin receptor TIR domain 0.0000835
Further Details:      
 
Domain Number 3 Region: 119-430
Classification Level Classification E-value
Superfamily L domain-like 4.95e-34
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000105671
Domain Number - Region: 53-98
Classification Level Classification E-value
Superfamily L domain-like 0.017
Family Internalin LRR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105671   Gene: ENSDARG00000068812   Transcript: ENSDART00000130393
Sequence length 1051
Comment pep:known chromosome:Zv9:9:56163682:56166837:1 gene:ENSDARG00000068812 transcript:ENSDART00000130393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIFLFQMTEKTMIIFASFISLLVAAEWYPKSLKCDVSLASNGTEVSVDCTERSLTEVPLG
IPTNTTNLTLTINHIPHVMNNSFDNLHNITEIDLRCNCVPVKVGPKDRVCSQSVSIDNGT
FWKLKNLKSLYLDGNQLSSIPKGLPANIVLLSLEINSIYSILQENLTELTNIRTLYLGQN
CYFRNPCNQSYYIEKDAFMLLDKMTLLSLKSNNLSYIPNQLPSSLKELYLYNNNIEKITE
NDFCNLTELEVLDLSGNCPRCYNAPFPCIPCPNNAPLQIHPNSFKTLRNLKTLRLHSNSL
TNIPPEWFQSLADLTLLDLSSNFLAKEITCTSFPSLLPKLEELDLSFNYELQVYPASLSL
SESFSQLKSLRVLRIRGYVFQELKLQDIQPLTNLTYLEFLDLGTNFIKIAQLSILKNLKN
FKIINLSDNKISVPSEGEFSFSNHREAYYGSPMSQGAQYHNGEVKDMHYFLYDEFARSCK
YKDKELWIPSPFNNDCSSFGKTLDISRNNIFFLHSKFLNLGELRCLNLSGNAMSQSLNGS
EFVQLTNLQYLDFTDNRLDLMYPSAFQELSNLVVLDISRNSHYFVAEGLTHMLNFTENLS
KLRKLIMNDNQISTSTNTEMKSYKLEHLEFKGNRLDMLWRDGDTRYVNYFKNLMSLKTLD
ISRNNLNFIPLVVFQGLPNTLTKLYITDNKLKLFKWEGLVYLKSLLLLDLTGNLLTEVPS
CLSNYTKSIQTLVLSKNKIVKLSPNFLKDAFSLKILDLSYNSIQFIDESSFPENVIDHLQ
TLYLNNNMFVCSCNATWLVRWINRTSVNIPRLASDVTCASPSAQKGQSVIFLNLQACQHN
SLSIILCIFQTTLILTILTLTISSHLFLWDVWYIYHFCLAKLKGYRRLSSNSAVYDAFVI
YDTTDPAVQEWVMQELRVHLEDKGDPRMNLCLEERDWVPGCPLIENLSQSIQLSQRTVFI
LTERYIRSGSFRTAFYLAHQRLMDERNDVIVLIFLERMPCHSKYLRLRKRLYKKSVLEWP
RNPQAQRYFWFSLRSLMATESQYNTLFQETL
Download sequence
Identical sequences ENSDARP00000105671 ENSDARP00000105671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]